Psyllid ID: psy9363
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 421 | ||||||
| 156544686 | 525 | PREDICTED: tubulin-specific chaperone E- | 0.536 | 0.430 | 0.358 | 3e-29 | |
| 91079236 | 517 | PREDICTED: similar to beta-tubulin cofac | 0.541 | 0.441 | 0.314 | 4e-29 | |
| 119590429 | 464 | tubulin-specific chaperone e, isoform CR | 0.534 | 0.484 | 0.323 | 1e-27 | |
| 326429505 | 354 | hypothetical protein PTSG_06731 [Salping | 0.498 | 0.593 | 0.331 | 1e-26 | |
| 383850534 | 527 | PREDICTED: tubulin-specific chaperone E- | 0.529 | 0.423 | 0.332 | 2e-26 | |
| 77748012 | 306 | Zgc:123075 [Danio rerio] | 0.539 | 0.741 | 0.347 | 3e-26 | |
| 307182233 | 705 | Tubulin-specific chaperone E [Camponotus | 0.524 | 0.313 | 0.327 | 5e-26 | |
| 307210248 | 527 | Tubulin-specific chaperone E [Harpegnath | 0.527 | 0.421 | 0.342 | 8e-26 | |
| 332026204 | 432 | Tubulin-specific chaperone E [Acromyrmex | 0.494 | 0.481 | 0.358 | 2e-25 | |
| 350400723 | 746 | PREDICTED: tubulin-specific chaperone E- | 0.522 | 0.294 | 0.326 | 7e-25 |
| >gi|156544686|ref|XP_001605321.1| PREDICTED: tubulin-specific chaperone E-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 135 bits (341), Expect = 3e-29, Method: Compositional matrix adjust.
Identities = 106/296 (35%), Positives = 146/296 (49%), Gaps = 70/296 (23%)
Query: 185 IGLRVCDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHSTTSGS 244
IG RV D EGH GT++YVG+V T+G W GIDWD +RGKH+G++ G+KYF T TSGS
Sbjct: 8 IGCRV-DCEGHIGTVKYVGTVGNTKGQWLGIDWDDPSRGKHNGTYEGLKYFETWHPTSGS 66
Query: 245 FMRRDKLNFGSSFMEALHRKYVETDNELT--VRENVEEVKASINAPFLELVGFDQVHEEQ 302
F+R K NFG S EA+ +Y D+EL R+++ V+ SINAPF+E+VGF +V+++Q
Sbjct: 67 FIRPGKANFGISCPEAIKVRYGYIDDELAGIDRDSIASVQKSINAPFVEMVGFSKVNKKQ 126
Query: 303 NT-NKLPI-------------PNDTSGVMEQIFPQGHIHTLTLGNMGYIWADI---LKLL 345
+ ++L I P + + + I H L N + A+I L++L
Sbjct: 127 SKFDQLKIVCMQAQCISSAGYPGELAALCSMIEELDLSHNLI--NSWKVVAEICTELQIL 184
Query: 346 AN--------------------FPV-----------------TCLK-LPS--------NR 359
FPV CLK PS N
Sbjct: 185 QQLNVSDNHLPVENGMEIYAHAFPVLRHLTMGRMKYDWPAVMQCLKAFPSIQELIVSYNN 244
Query: 360 ITTLDSVPGMFS--SLEELYLQENNIVDWGEVNALGSLPNLKYLNLASTNLRNIKL 413
I T+ V + L EL L+ N I +W EV LG LP LK LNL S + +I+
Sbjct: 245 IETISGVEESLNIMKLTELSLEHNLISNWNEVLKLGILPCLKGLNLNSNKIEDIRF 300
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91079236|ref|XP_970901.1| PREDICTED: similar to beta-tubulin cofactor E [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|119590429|gb|EAW70023.1| tubulin-specific chaperone e, isoform CRA_c [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|326429505|gb|EGD75075.1| hypothetical protein PTSG_06731 [Salpingoeca sp. ATCC 50818] | Back alignment and taxonomy information |
|---|
| >gi|383850534|ref|XP_003700850.1| PREDICTED: tubulin-specific chaperone E-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|77748012|gb|AAI07630.1| Zgc:123075 [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|307182233|gb|EFN69564.1| Tubulin-specific chaperone E [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307210248|gb|EFN86898.1| Tubulin-specific chaperone E [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332026204|gb|EGI66346.1| Tubulin-specific chaperone E [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|350400723|ref|XP_003485937.1| PREDICTED: tubulin-specific chaperone E-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 421 | ||||||
| ZFIN|ZDB-GENE-051030-120 | 521 | tbce "tubulin folding cofactor | 0.287 | 0.232 | 0.429 | 7e-28 | |
| UNIPROTKB|Q32KS0 | 528 | TBCE "Tubulin-specific chapero | 0.524 | 0.418 | 0.333 | 1.6e-22 | |
| UNIPROTKB|Q5U508 | 522 | tbce "Tubulin-specific chapero | 0.496 | 0.400 | 0.337 | 8.5e-22 | |
| UNIPROTKB|Q15813 | 527 | TBCE "Tubulin-specific chapero | 0.505 | 0.404 | 0.327 | 1.1e-20 | |
| UNIPROTKB|Q5RBD9 | 527 | TBCE "Tubulin-specific chapero | 0.503 | 0.402 | 0.334 | 1.1e-20 | |
| ASPGD|ASPL0000026995 | 606 | AN5531 [Emericella nidulans (t | 0.258 | 0.179 | 0.422 | 1.4e-20 | |
| FB|FBgn0033055 | 542 | tbce "tubulin-specific chapero | 0.522 | 0.405 | 0.288 | 1.6e-20 | |
| MGI|MGI:1917680 | 524 | Tbce "tubulin-specific chapero | 0.520 | 0.417 | 0.314 | 1.3e-19 | |
| DICTYBASE|DDB_G0269990 | 525 | tbcE "tubulin binding cofactor | 0.491 | 0.394 | 0.336 | 4.9e-19 | |
| UNIPROTKB|B7Z3P1 | 578 | TBCE "cDNA FLJ59210, highly si | 0.465 | 0.339 | 0.327 | 1.4e-18 |
| ZFIN|ZDB-GENE-051030-120 tbce "tubulin folding cofactor E" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 277 (102.6 bits), Expect = 7.0e-28, Sum P(2) = 7.0e-28
Identities = 55/128 (42%), Positives = 82/128 (64%)
Query: 180 VMEDDIGLRVCDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHS 239
++++ +G RVC +G RGT+RYVG V T GVW G++WD RGKHDGSH+GV+YF
Sbjct: 2 MLDEAVGRRVC-CDGERGTVRYVGPVPPTAGVWLGVEWDHPERGKHDGSHDGVRYFTCRH 60
Query: 240 TTSGSFMRRDKLNFGSSFMEALHRKYVETDNELTVRENVEEVKASINAPFLELVGFDQVH 299
T GSF+R K +FG ++ AL ++Y E+T EE+K I++ + +VGF+ V
Sbjct: 61 PTGGSFVRPQKASFGVDYVTALKQRYEVEIEEVTA----EEMK--ISSKTVVMVGFENVK 114
Query: 300 EEQNTNKL 307
++Q+ L
Sbjct: 115 KKQSVKNL 122
|
|
| UNIPROTKB|Q32KS0 TBCE "Tubulin-specific chaperone E" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5U508 tbce "Tubulin-specific chaperone E" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15813 TBCE "Tubulin-specific chaperone E" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RBD9 TBCE "Tubulin-specific chaperone E" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000026995 AN5531 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033055 tbce "tubulin-specific chaperone E" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917680 Tbce "tubulin-specific chaperone E" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0269990 tbcE "tubulin binding cofactor E" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z3P1 TBCE "cDNA FLJ59210, highly similar to Tubulin-specific chaperone E" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 421 | |||
| smart01052 | 68 | smart01052, CAP_GLY, Cytoskeleton-associated prote | 4e-21 | |
| pfam01302 | 67 | pfam01302, CAP_GLY, CAP-Gly domain | 8e-21 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 4e-06 | |
| COG5244 | 669 | COG5244, NIP100, Dynactin complex subunit involved | 7e-06 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 8e-06 |
| >gnl|CDD|214997 smart01052, CAP_GLY, Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network | Back alignment and domain information |
|---|
Score = 86.1 bits (214), Expect = 4e-21
Identities = 30/68 (44%), Positives = 38/68 (55%), Gaps = 2/68 (2%)
Query: 185 IGLRV-CDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHSTTSG 243
+G RV G RGT+RYVG GVW G++ D RGK+DGS GV+YF G
Sbjct: 1 VGDRVEVGGGGRRGTVRYVGPTPFAPGVWVGVELDEPLRGKNDGSVKGVRYF-ECPPKHG 59
Query: 244 SFMRRDKL 251
F+R K+
Sbjct: 60 IFVRPSKV 67
|
A conserved motif, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of Caenorhabditis elegans F53F4.3 protein CAP-Gly domain was recently solved. The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove. Length = 68 |
| >gnl|CDD|216424 pfam01302, CAP_GLY, CAP-Gly domain | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227569 COG5244, NIP100, Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 421 | |||
| KOG3207|consensus | 505 | 99.97 | ||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.86 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.85 | |
| KOG2982|consensus | 418 | 99.78 | ||
| KOG4194|consensus | 873 | 99.77 | ||
| KOG0444|consensus | 1255 | 99.7 | ||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.67 | |
| KOG0472|consensus | 565 | 99.66 | ||
| KOG3207|consensus | 505 | 99.66 | ||
| KOG4194|consensus | 873 | 99.65 | ||
| KOG0444|consensus | 1255 | 99.62 | ||
| KOG0618|consensus | 1081 | 99.59 | ||
| KOG0472|consensus | 565 | 99.49 | ||
| KOG1644|consensus | 233 | 99.37 | ||
| KOG4237|consensus | 498 | 99.31 | ||
| PF01302 | 69 | CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytos | 99.28 | |
| KOG0618|consensus | 1081 | 99.26 | ||
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.21 | |
| KOG3206|consensus | 234 | 99.1 | ||
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.99 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.97 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.94 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.92 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.87 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.82 | |
| KOG4237|consensus | 498 | 98.81 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.71 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.68 | |
| KOG0617|consensus | 264 | 98.65 | ||
| KOG2123|consensus | 388 | 98.63 | ||
| KOG0617|consensus | 264 | 98.63 | ||
| COG5244 | 669 | NIP100 Dynactin complex subunit involved in mitoti | 98.62 | |
| KOG2739|consensus | 260 | 98.49 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.4 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.39 | |
| KOG2982|consensus | 418 | 98.35 | ||
| PLN03150 | 623 | hypothetical protein; Provisional | 98.31 | |
| KOG1259|consensus | 490 | 98.31 | ||
| KOG0971|consensus | 1243 | 98.22 | ||
| KOG1259|consensus | 490 | 98.2 | ||
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.14 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.98 | |
| KOG1644|consensus | 233 | 97.95 | ||
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.94 | |
| KOG4579|consensus | 177 | 97.76 | ||
| KOG4579|consensus | 177 | 97.72 | ||
| KOG1909|consensus | 382 | 97.68 | ||
| KOG0531|consensus | 414 | 97.59 | ||
| KOG1859|consensus | 1096 | 97.55 | ||
| KOG1859|consensus | 1096 | 97.53 | ||
| KOG1909|consensus | 382 | 97.52 | ||
| KOG4568|consensus | 664 | 97.51 | ||
| KOG3665|consensus | 699 | 97.42 | ||
| KOG2123|consensus | 388 | 97.41 | ||
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.3 | |
| KOG0531|consensus | 414 | 97.01 | ||
| KOG2120|consensus | 419 | 96.99 | ||
| KOG2739|consensus | 260 | 96.97 | ||
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.96 | |
| KOG0532|consensus | 722 | 96.95 | ||
| KOG3763|consensus | 585 | 96.93 | ||
| KOG0532|consensus | 722 | 96.63 | ||
| KOG4658|consensus | 889 | 96.59 | ||
| KOG3556|consensus | 724 | 96.51 | ||
| KOG3665|consensus | 699 | 96.39 | ||
| KOG2120|consensus | 419 | 96.36 | ||
| KOG4658|consensus | 889 | 95.76 | ||
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 95.67 | |
| KOG3763|consensus | 585 | 93.89 | ||
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.73 | |
| KOG0241|consensus | 1714 | 93.09 | ||
| KOG4568|consensus | 664 | 92.89 | ||
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 92.82 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 91.56 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 91.12 | |
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 90.79 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 90.49 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 89.29 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 89.29 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 89.1 | |
| KOG1947|consensus | 482 | 88.36 | ||
| KOG4308|consensus | 478 | 87.94 | ||
| smart00446 | 26 | LRRcap occurring C-terminal to leucine-rich repeat | 87.68 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 87.53 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 87.53 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 85.99 | |
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 83.83 | |
| KOG0473|consensus | 326 | 83.79 | ||
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 83.2 | |
| KOG1947|consensus | 482 | 82.83 | ||
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 81.34 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 80.11 |
| >KOG3207|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=7e-31 Score=248.76 Aligned_cols=228 Identities=32% Similarity=0.627 Sum_probs=189.9
Q ss_pred cCCCCceEEeecCceeEEEEecccCCCCCcEEEEEecCCCCCCCCCeeCCEEeEecCCCCceeEEecCccccCchhHHHh
Q psy9363 182 EDDIGLRVCDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHSTTSGSFMRRDKLNFGSSFMEAL 261 (421)
Q Consensus 182 ~~~i~~rv~~l~~~~~~~r~~G~ip~~~g~~~gle~d~~~~g~~~G~~~g~~~f~~~~~~~gsf~~~~~l~~g~~~~~al 261 (421)
.+.+|.|+. +++.++|+||+|.|+++.|.|+||||||..||||+|.++|.+||+|..|+.|||+++.++..+.++..++
T Consensus 2 ~~~IG~Rvk-I~~~~~Tvr~iG~V~g~~~~w~GvEWDd~~RGKH~G~vdgk~YF~~q~P~GGSFik~~kV~~p~d~~~t~ 80 (505)
T KOG3207|consen 2 TMEIGTRVK-IGGEIATVRYIGEVEGNNSKWYGVEWDDPVRGKHDGIVDGKRYFQTQHPNGGSFIKPGKVKFPTDLLRTF 80 (505)
T ss_pred ceeccceEE-EcCEEEEEEEEEEEcCCCCcceeeEecCCCccccCceecceeeeeeecCCCccccCCccCCCCccHHHHH
Confidence 356899998 9999999999999999999999999999999999999999999999999999999999999888999999
Q ss_pred hhhhccccchhhhccccceeeeeecCceeEeecccchhhhh----CCCccCCCC---CCCc--hhhhcCCCCCccEEEee
Q psy9363 262 HRKYVETDNELTVRENVEEVKASINAPFLELVGFDQVHEEQ----NTNKLPIPN---DTSG--VMEQIFPQGHIHTLTLG 332 (421)
Q Consensus 262 ~~~y~~~~~~~~~~~~~~~~~~~~~~~~~e~~g~~~l~~~~----~L~~l~l~~---~~~~--~~~~~l~~~~L~~L~Ls 332 (421)
.++|...... +.+....+.++++.+|.+||+++..++ +|+.+.|.+ +..+ .....| ++++.||||
T Consensus 81 ~ery~e~~s~----~sd~~~~~si~nK~vE~iGfDki~akQsn~kkL~~IsLdn~~V~~~~~~~~~k~~--~~v~~LdLS 154 (505)
T KOG3207|consen 81 KERYYEKYSY----SSDLESVLSISNKQVEFIGFDKIAAKQSNLKKLREISLDNYRVEDAGIEEYSKIL--PNVRDLDLS 154 (505)
T ss_pred HHHHHHhhcC----CcchhhHhhhcCceeEEecHHHHHHHhhhHHhhhheeecCccccccchhhhhhhC--Ccceeecch
Confidence 9999877542 222233456889999999999999888 566667776 3333 467889 999999999
Q ss_pred Ccccc-hhhHHHHhccCCC-cEEEccCCcCcc-cCCC-------------------------------------------
Q psy9363 333 NMGYI-WADILKLLANFPV-TCLKLPSNRITT-LDSV------------------------------------------- 366 (421)
Q Consensus 333 ~N~l~-~~~i~~~~~~l~~-~~L~L~~N~l~~-l~~~------------------------------------------- 366 (421)
.|.|+ |..+.+++..+|+ +.|+|+.|++.- ....
T Consensus 155 ~NL~~nw~~v~~i~eqLp~Le~LNls~Nrl~~~~~s~~~~~l~~lK~L~l~~CGls~k~V~~~~~~fPsl~~L~L~~N~~ 234 (505)
T KOG3207|consen 155 RNLFHNWFPVLKIAEQLPSLENLNLSSNRLSNFISSNTTLLLSHLKQLVLNSCGLSWKDVQWILLTFPSLEVLYLEANEI 234 (505)
T ss_pred hhhHHhHHHHHHHHHhcccchhcccccccccCCccccchhhhhhhheEEeccCCCCHHHHHHHHHhCCcHHHhhhhcccc
Confidence 99999 9999999999999 999999999962 1000
Q ss_pred -------CCCCCCCcEEECcCCCCCCCCcccccCccccccccccccccCcccCCCCC
Q psy9363 367 -------PGMFSSLEELYLQENNIVDWGEVNALGSLPNLKYLNLASTNLRNIKLNKE 416 (421)
Q Consensus 367 -------~~~l~~L~~L~Ls~N~l~~~~~~~~l~~l~~L~~L~Ls~N~l~~i~~p~~ 416 (421)
...+..|++|||++|++-+.+....++.+|.|..|+++.+.+++|..|+.
T Consensus 235 ~~~~~~~~~i~~~L~~LdLs~N~li~~~~~~~~~~l~~L~~Lnls~tgi~si~~~d~ 291 (505)
T KOG3207|consen 235 ILIKATSTKILQTLQELDLSNNNLIDFDQGYKVGTLPGLNQLNLSSTGIASIAEPDV 291 (505)
T ss_pred cceecchhhhhhHHhhccccCCcccccccccccccccchhhhhccccCcchhcCCCc
Confidence 02244567777777777776666677788888888888888888888876
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >KOG3207|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >PF01302 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytoskeleton-associated proteins (CAP) are made of three distinct parts, an N-terminal section that is most probably globular and contains the CAP-Gly domain, a large central region predicted to be in an alpha-helical coiled-coil conformation and, finally, a short C-terminal globular domain | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG3206|consensus | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >COG5244 NIP100 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >KOG1909|consensus | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >KOG1859|consensus | Back alignment and domain information |
|---|
| >KOG1859|consensus | Back alignment and domain information |
|---|
| >KOG1909|consensus | Back alignment and domain information |
|---|
| >KOG4568|consensus | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >KOG2120|consensus | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0532|consensus | Back alignment and domain information |
|---|
| >KOG3763|consensus | Back alignment and domain information |
|---|
| >KOG0532|consensus | Back alignment and domain information |
|---|
| >KOG4658|consensus | Back alignment and domain information |
|---|
| >KOG3556|consensus | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >KOG2120|consensus | Back alignment and domain information |
|---|
| >KOG4658|consensus | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3763|consensus | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >KOG4568|consensus | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1947|consensus | Back alignment and domain information |
|---|
| >KOG4308|consensus | Back alignment and domain information |
|---|
| >smart00446 LRRcap occurring C-terminal to leucine-rich repeats | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >KOG0473|consensus | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG1947|consensus | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 421 | ||||
| 1whg_A | 113 | Solution Structure Of The Cap-Gly Domain In Mouse T | 3e-06 | ||
| 1txq_A | 93 | Crystal Structure Of The Eb1 C-Terminal Domain Comp | 8e-06 | ||
| 2hkn_A | 97 | Crystal Structure Of The Cap-Gly Domain Of Human Dy | 9e-06 | ||
| 2coy_A | 112 | Solution Structure Of The Cap-Gly Domain In Human D | 9e-06 | ||
| 3tq7_P | 71 | Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Do | 1e-05 | ||
| 2hl3_A | 97 | Crystal Structure Of The A49m Mutant Cap-Gly Domain | 2e-05 | ||
| 1whh_A | 102 | Solution Structure Of The 2nd Cap-Gly Domain In Mou | 2e-05 | ||
| 2cp0_A | 95 | Solution Structure Of The 1st Cap-Gly Domain In Hum | 2e-05 | ||
| 1lpl_A | 95 | Structural Genomics Of Caenorhabditis Elegans: Cap- | 7e-05 | ||
| 1tov_A | 98 | Structural Genomics Of Caenorhabditis Elegans: Cap- | 8e-05 | ||
| 2z0w_A | 96 | Crystal Structure Of The 2nd Cap-Gly Domain In Huma | 4e-04 |
| >pdb|1WHG|A Chain A, Solution Structure Of The Cap-Gly Domain In Mouse Tubulin Specific Chaperone B Length = 113 | Back alignment and structure |
|
| >pdb|1TXQ|A Chain A, Crystal Structure Of The Eb1 C-Terminal Domain Complexed With The Cap-Gly Domain Of P150glued Length = 93 | Back alignment and structure |
| >pdb|2HKN|A Chain A, Crystal Structure Of The Cap-Gly Domain Of Human Dynactin-1 (P150- Glued) Length = 97 | Back alignment and structure |
| >pdb|2COY|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Dynactin 1 Length = 112 | Back alignment and structure |
| >pdb|3TQ7|P Chain P, Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Domain Of P150glued Length = 71 | Back alignment and structure |
| >pdb|2HL3|A Chain A, Crystal Structure Of The A49m Mutant Cap-Gly Domain Of Human Dynactin-1 (P150-Glued) In Complex With Human Eb1 C- Terminal Hexapeptide Length = 97 | Back alignment and structure |
| >pdb|1WHH|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Mouse Clip170-Related 59kda Protein Clipr-59 Length = 102 | Back alignment and structure |
| >pdb|2CP0|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170-Related Protein Clipr59 Length = 95 | Back alignment and structure |
| >pdb|1LPL|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 95 | Back alignment and structure |
| >pdb|1TOV|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 98 | Back alignment and structure |
| >pdb|2Z0W|A Chain A, Crystal Structure Of The 2nd Cap-Gly Domain In Human Restin- Like Protein 2 Reveals A Swapped-Dimer Length = 96 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 421 | |||
| 2z0w_A | 96 | CAP-Gly domain-containing linker protein 4; altern | 7e-25 | |
| 2cp5_A | 141 | Restin; microtubule binding, cytoskeleton associat | 1e-23 | |
| 1ixd_A | 104 | Cylindromatosis tumour-suppressor CYLD; structural | 2e-23 | |
| 2cp0_A | 95 | Clipr-59 protein, clipr59; microtubule binding, cy | 3e-23 | |
| 2cow_A | 100 | Kinesin-like protein KIF13B; microtubule binding, | 5e-23 | |
| 2e3h_A | 90 | Restin; CAP-Gly, cytoplasmic linker, tubulin bindi | 7e-23 | |
| 1whh_A | 102 | Clipr-59; microtubule binding, trans-golgi network | 7e-23 | |
| 2cp3_A | 84 | CLIP-115, KIAA0291; microtubule binding, cytoskele | 8e-23 | |
| 2e3i_A | 86 | Restin; CAP-Gly, cytoplasmic linker, tubulin bindi | 9e-23 | |
| 3rdv_A | 72 | CAP-Gly domain-containing linker protein 1; cytosk | 1e-22 | |
| 2coy_A | 112 | Dynactin-1; microtubule binding, cytoskeleton asso | 2e-22 | |
| 1whk_A | 91 | 1700024K14RIK, riken cDNA 1700024K14; structural g | 2e-22 | |
| 1whj_A | 102 | 1700024K14RIK, riken cDNA 1700024K14; structural g | 3e-22 | |
| 2cp2_A | 95 | CLIP-115, KIAA0291; microtubule binding, cytoskele | 3e-22 | |
| 1txq_A | 93 | Dynactin 1; protein complex, structural protein/pr | 4e-22 | |
| 2coz_A | 122 | CAP350, centrosome-associated protein 350; microtu | 6e-22 | |
| 2cp6_A | 172 | Restin; microtubule binding, cytoskeleton associat | 1e-21 | |
| 1lpl_A | 95 | Hypothetical 25.4 kDa protein F53F4.3 in chromosom | 4e-21 | |
| 1whg_A | 113 | Tubulin specific chaperone B; microtubule binding, | 3e-20 | |
| 1whl_A | 95 | Cylindromatosis tumor suppressor CYLD; deubiquitin | 1e-18 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 2e-08 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 9e-05 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-08 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 7e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-05 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 5e-04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-08 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 2e-05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-08 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-08 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 6e-07 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-06 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 5e-08 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-06 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 6e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 8e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 7e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 7e-08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-07 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 8e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 6e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 9e-08 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 9e-08 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-04 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 5e-04 | |
| 1whm_A | 92 | Cylindromatosis tumor suppressor CYLD; deubiquitin | 1e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 7e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-07 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-07 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 6e-07 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 7e-07 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 9e-07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 7e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 7e-05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 8e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-07 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 7e-07 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 7e-06 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 8e-04 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-07 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 6e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 5e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 6e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-07 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-07 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 4e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 6e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 7e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-04 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 5e-07 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 5e-07 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 5e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 3e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 7e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 5e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 7e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 9e-07 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 1e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-04 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 9e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 6e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 7e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 8e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 6e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 6e-04 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-06 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-06 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 4e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 7e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 7e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 5e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 6e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 5e-06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-05 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 7e-06 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 3e-04 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 7e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-05 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-05 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-05 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-05 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 6e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 5e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 9e-06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 4e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 6e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 5e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-05 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-05 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 1e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 3e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 3e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 9e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 9e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-04 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 9e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 5e-04 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-04 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-04 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 5e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-04 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-04 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 3e-04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 3e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 3e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 9e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 4e-04 |
| >2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
Score = 96.7 bits (241), Expect = 7e-25
Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
Query: 185 IGLRVCDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHSTTSGS 244
+G RV GTIR+ G+ G WYGI+ + + GK+DGS GV+YF S G
Sbjct: 13 LGERVLVVGQRLGTIRFFGTTNFAPGYWYGIELE-KPHGKNDGSVGGVQYFSC-SPRYGI 70
Query: 245 FMRRDKLNFGSSFMEALHRKY 265
F ++ + ++ L
Sbjct: 71 FAPPSRVQRVTDSLDTLSEIS 91
|
| >2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 141 | Back alignment and structure |
|---|
| >1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 104 | Back alignment and structure |
|---|
| >2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 | Back alignment and structure |
|---|
| >2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 100 | Back alignment and structure |
|---|
| >2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Length = 90 | Back alignment and structure |
|---|
| >1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 | Back alignment and structure |
|---|
| >2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 84 | Back alignment and structure |
|---|
| >2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Length = 86 | Back alignment and structure |
|---|
| >3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Length = 72 | Back alignment and structure |
|---|
| >2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 112 | Back alignment and structure |
|---|
| >1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 91 | Back alignment and structure |
|---|
| >1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 | Back alignment and structure |
|---|
| >2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Length = 95 | Back alignment and structure |
|---|
| >1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Length = 93 | Back alignment and structure |
|---|
| >2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 122 | Back alignment and structure |
|---|
| >2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 172 | Back alignment and structure |
|---|
| >1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Length = 95 | Back alignment and structure |
|---|
| >1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Length = 113 | Back alignment and structure |
|---|
| >1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 92 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 421 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.89 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.87 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.87 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.85 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.84 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.83 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.82 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.82 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.81 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.81 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.8 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.8 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.8 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.8 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.8 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.79 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.78 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.78 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.78 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.78 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.77 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.77 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.77 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.76 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.76 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.75 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.74 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.74 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.73 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.73 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.73 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.72 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.72 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.72 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.72 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.71 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.71 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.71 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.7 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.7 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.69 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.69 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.69 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.68 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.67 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.67 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.67 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.67 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.66 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.65 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.64 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.63 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.63 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.62 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.61 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.61 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.61 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.59 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.59 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.58 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.58 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.57 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.57 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.57 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.57 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.56 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.55 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.55 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.54 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.54 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.53 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.52 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.51 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.5 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.5 | |
| 2z0w_A | 96 | CAP-Gly domain-containing linker protein 4; altern | 99.49 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.47 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.45 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.45 | |
| 4b6m_A | 84 | Tubulin-specific chaperone, putative; structural p | 99.44 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.44 | |
| 1lpl_A | 95 | Hypothetical 25.4 kDa protein F53F4.3 in chromosom | 99.44 | |
| 2e3i_A | 86 | Restin; CAP-Gly, cytoplasmic linker, tubulin bindi | 99.44 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.44 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.43 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.43 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.43 | |
| 3rdv_A | 72 | CAP-Gly domain-containing linker protein 1; cytosk | 99.43 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.43 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.42 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.41 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.41 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.4 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.39 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.39 | |
| 1ixd_A | 104 | Cylindromatosis tumour-suppressor CYLD; structural | 99.38 | |
| 2e3h_A | 90 | Restin; CAP-Gly, cytoplasmic linker, tubulin bindi | 99.37 | |
| 2cp2_A | 95 | CLIP-115, KIAA0291; microtubule binding, cytoskele | 99.36 | |
| 1whg_A | 113 | Tubulin specific chaperone B; microtubule binding, | 99.36 | |
| 2cp0_A | 95 | Clipr-59 protein, clipr59; microtubule binding, cy | 99.35 | |
| 2cp3_A | 84 | CLIP-115, KIAA0291; microtubule binding, cytoskele | 99.34 | |
| 1whh_A | 102 | Clipr-59; microtubule binding, trans-golgi network | 99.34 | |
| 1whl_A | 95 | Cylindromatosis tumor suppressor CYLD; deubiquitin | 99.34 | |
| 1txq_A | 93 | Dynactin 1; protein complex, structural protein/pr | 99.34 | |
| 1whk_A | 91 | 1700024K14RIK, riken cDNA 1700024K14; structural g | 99.33 | |
| 1whj_A | 102 | 1700024K14RIK, riken cDNA 1700024K14; structural g | 99.32 | |
| 2cp6_A | 172 | Restin; microtubule binding, cytoskeleton associat | 99.32 | |
| 2coz_A | 122 | CAP350, centrosome-associated protein 350; microtu | 99.31 | |
| 2coy_A | 112 | Dynactin-1; microtubule binding, cytoskeleton asso | 99.3 | |
| 2cp5_A | 141 | Restin; microtubule binding, cytoskeleton associat | 99.29 | |
| 2cow_A | 100 | Kinesin-like protein KIF13B; microtubule binding, | 99.28 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.26 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.24 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.24 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.24 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.23 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.2 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.19 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.18 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.17 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.17 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.16 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.15 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.15 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.11 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.1 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.1 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.1 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.1 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.1 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.08 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.08 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.08 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.08 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.07 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.04 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.04 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.04 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.01 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.0 | |
| 1whm_A | 92 | Cylindromatosis tumor suppressor CYLD; deubiquitin | 98.98 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.98 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.96 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.96 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.95 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.94 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.93 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.93 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.91 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.91 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.88 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.88 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.88 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.85 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.83 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.82 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.8 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.79 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.76 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.7 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.65 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.46 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.41 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.38 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.38 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.22 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.92 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.5 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.32 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 97.16 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.13 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.0 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.87 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.79 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 96.61 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.24 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.67 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 95.34 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 93.27 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 92.58 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 88.55 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 87.9 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 86.82 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 82.23 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
Probab=99.89 E-value=1.2e-24 Score=233.42 Aligned_cols=103 Identities=21% Similarity=0.258 Sum_probs=85.7
Q ss_pred CCCchhhhcCCCCCccEEEeeCcccchhhHHHHhccCCC-cEEEccCCcCc-ccCCCCCCCCCCcEEECcCCCCCCCCcc
Q psy9363 312 DTSGVMEQIFPQGHIHTLTLGNMGYIWADILKLLANFPV-TCLKLPSNRIT-TLDSVPGMFSSLEELYLQENNIVDWGEV 389 (421)
Q Consensus 312 ~~~~~~~~~l~~~~L~~L~Ls~N~l~~~~i~~~~~~l~~-~~L~L~~N~l~-~l~~~~~~l~~L~~L~Ls~N~l~~~~~~ 389 (421)
+.+|..+..+ ++|+.|+|++|.++ +.+|..+..++. +.|+|++|+++ .+|..++.+++|+.|||++|++ .+.++
T Consensus 622 g~~~~~~~~l--~~L~~LdLs~N~l~-g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l-~g~ip 697 (768)
T 3rgz_A 622 GHTSPTFDNN--GSMMFLDMSYNMLS-GYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKL-DGRIP 697 (768)
T ss_dssp EECCCSCSSS--BCCCEEECCSSCCB-SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCC-EECCC
T ss_pred ccCchhhhcc--ccccEEECcCCccc-ccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcc-cCcCC
Confidence 5567777888 89999999999998 556677888888 99999999998 6777778899999999999999 44557
Q ss_pred cccCccccccccccccccCcccCCCCCCCC
Q psy9363 390 NALGSLPNLKYLNLASTNLRNIKLNKEGHY 419 (421)
Q Consensus 390 ~~l~~l~~L~~L~Ls~N~l~~i~~p~~~~~ 419 (421)
..++.++.|+.|++++|++++ ++|..+.|
T Consensus 698 ~~l~~l~~L~~L~ls~N~l~g-~iP~~~~~ 726 (768)
T 3rgz_A 698 QAMSALTMLTEIDLSNNNLSG-PIPEMGQF 726 (768)
T ss_dssp GGGGGCCCCSEEECCSSEEEE-ECCSSSSG
T ss_pred hHHhCCCCCCEEECcCCcccc-cCCCchhh
Confidence 788899999999999999988 77776554
|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4b6m_A Tubulin-specific chaperone, putative; structural protein; 1.59A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A | Back alignment and structure |
|---|
| >2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A | Back alignment and structure |
|---|
| >2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A | Back alignment and structure |
|---|
| >1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P | Back alignment and structure |
|---|
| >1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 421 | ||||
| d1ixda_ | 104 | b.34.10.1 (A:) Cylindromatosis tumour-suppressor C | 3e-20 | |
| d1whha_ | 102 | b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR | 6e-20 | |
| d2cp0a1 | 83 | b.34.10.1 (A:7-89) CLIP170-related 59kda protein C | 3e-19 | |
| d2e3ha1 | 71 | b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapien | 6e-19 | |
| d2cowa1 | 88 | b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Hu | 1e-18 | |
| d2e3ia1 | 71 | b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) | 2e-18 | |
| d1whja_ | 102 | b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse | 2e-18 | |
| d2coza1 | 109 | b.34.10.1 (A:8-116) Centrosome-associated protein | 3e-18 | |
| d2cp6a1 | 160 | b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [ | 1e-17 | |
| d1whka_ | 91 | b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse | 2e-17 | |
| d1tova_ | 98 | b.34.10.1 (A:) Cytoskeleton-associated protein F53 | 3e-17 | |
| d2hqha1 | 72 | b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapien | 4e-17 | |
| d1whga_ | 113 | b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1 | 1e-16 | |
| d1whma_ | 92 | b.34.10.1 (A:) Cylindromatosis tumour-suppressor C | 6e-16 | |
| d1whla_ | 95 | b.34.10.1 (A:) Cylindromatosis tumour-suppressor C | 1e-15 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 8e-06 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-04 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.003 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-04 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 5e-04 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 6e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.003 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.004 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 0.004 |
| >d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: Cap-Gly domain family: Cap-Gly domain domain: Cylindromatosis tumour-suppressor Cyld species: Human (Homo sapiens) [TaxId: 9606]
Score = 83.4 bits (206), Expect = 3e-20
Identities = 18/70 (25%), Positives = 29/70 (41%), Gaps = 1/70 (1%)
Query: 188 RVCDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHSTTSGSFMR 247
V ++ G IR++G G V G++ + E G DG+ G +YF F++
Sbjct: 25 EVKENPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCAL-KKALFVK 83
Query: 248 RDKLNFGSSF 257
S F
Sbjct: 84 LKSCRPDSRF 93
|
| >d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 160 | Back information, alignment and structure |
|---|
| >d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 98 | Back information, alignment and structure |
|---|
| >d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 | Back information, alignment and structure |
|---|
| >d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 421 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.8 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.67 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.64 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.55 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.53 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.53 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.47 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.44 | |
| d2e3ia1 | 71 | Restin {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.42 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.4 | |
| d2hqha1 | 72 | Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d2cp0a1 | 83 | CLIP170-related 59kda protein CLIPR-59 (1500005P14 | 99.39 | |
| d2e3ha1 | 71 | CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d2cowa1 | 88 | Kinesin-like protein kif13b {Human (Homo sapiens) | 99.35 | |
| d1ixda_ | 104 | Cylindromatosis tumour-suppressor Cyld {Human (Hom | 99.32 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.31 | |
| d2coza1 | 109 | Centrosome-associated protein 350 {Human (Homo sap | 99.3 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.29 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.29 | |
| d1tova_ | 98 | Cytoskeleton-associated protein F53F4.3 {Caenorhab | 99.28 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.27 | |
| d1whja_ | 102 | Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) | 99.27 | |
| d2cp6a1 | 160 | Restin {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d1whka_ | 91 | Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) | 99.26 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.24 | |
| d1whha_ | 102 | CLIP170-related 59kda protein CLIPR-59 (1500005P14 | 99.24 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.23 | |
| d1whga_ | 113 | Tubulin-specific chaperone B (SKAP1) {Mouse (Mus m | 99.22 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.22 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.22 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.2 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.16 | |
| d1whma_ | 92 | Cylindromatosis tumour-suppressor Cyld {Human (Hom | 99.16 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.09 | |
| d1whla_ | 95 | Cylindromatosis tumour-suppressor Cyld {Human (Hom | 99.08 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.04 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.95 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.95 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.9 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.89 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.85 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.84 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.82 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.76 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.75 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.7 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.63 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.57 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.49 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.47 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.15 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.96 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.84 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.58 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.16 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.9 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.80 E-value=7.6e-21 Score=179.82 Aligned_cols=257 Identities=18% Similarity=0.137 Sum_probs=177.4
Q ss_pred CCcEEECCCCCCCChhhHHHHHhcCCCCceeec-c-cccCCCCCCcccccccccchhccccccCCcchhhHHHHHhhCCC
Q psy9363 21 FIEDLDLSRNLLASWFAVGEITCQLKHLRHLNL-R-IRLKSSSAPAHSYLAEVVFFVHLGRTLCDEDFVKEGSLLHYLPK 98 (421)
Q Consensus 21 ~L~~L~Ls~N~ls~~~~i~~~~~~l~~L~~L~L-~-N~l~~~~~p~~~~~~~~L~~L~L~~~~~~~~~~~~~~ll~~l~~ 98 (421)
+++.|||++|.++....+|..+++|++|++|+| + |.+. +.+|..++.+++|++|+|++|.+.+..... +..+++
T Consensus 51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~-g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~---~~~~~~ 126 (313)
T d1ogqa_ 51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLV-GPIPPAIAKLTQLHYLYITHTNVSGAIPDF---LSQIKT 126 (313)
T ss_dssp CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEE-SCCCGGGGGCTTCSEEEEEEECCEEECCGG---GGGCTT
T ss_pred EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccc-cccccccccccccchhhhcccccccccccc---ccchhh
Confidence 699999999999965578889999999999999 4 7888 689999999999999999988776654444 667999
Q ss_pred CceeeecCCCCCCccccchhHHHHHHhccCceeccCCccChhhhhccHHHHHHhhccccchhhHHHHHHHhCCCCCCccc
Q psy9363 99 LSSLRFTKNPILAEERVVSSREKTIARLGGLKLLNGSAIERQERQGSEYDYIKEFGAVWLDEKRRAEFLEANPRVGDNYF 178 (421)
Q Consensus 99 L~~L~l~~N~l~~~~~~~~~~~~~i~~l~~L~~ln~s~i~~~~r~~ae~~~l~~~~~~~~~~~~~~~~~~~~~~~~~n~~ 178 (421)
|+++++++|.+.. ..+..++.++.|+.++.+..... +..+ ..+
T Consensus 127 L~~l~l~~N~~~~------~~p~~l~~l~~L~~l~l~~n~l~-------------~~ip------------------~~~ 169 (313)
T d1ogqa_ 127 LVTLDFSYNALSG------TLPPSISSLPNLVGITFDGNRIS-------------GAIP------------------DSY 169 (313)
T ss_dssp CCEEECCSSEEES------CCCGGGGGCTTCCEEECCSSCCE-------------EECC------------------GGG
T ss_pred hcccccccccccc------cCchhhccCcccceeeccccccc-------------cccc------------------ccc
Confidence 9999999998743 34567889999998888632111 1111 000
Q ss_pred ccccCCCCceEEeecCceeEEEEecccCCCCCcEEEEEecCCCCCCCCCeeCCEEeEecCCCCceeEEecCccccCchhH
Q psy9363 179 QVMEDDIGLRVCDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHSTTSGSFMRRDKLNFGSSFM 258 (421)
Q Consensus 179 ~~~~~~i~~rv~~l~~~~~~~r~~G~ip~~~g~~~gle~d~~~~g~~~G~~~g~~~f~~~~~~~gsf~~~~~l~~g~~~~ 258 (421)
... ......+ ....+++.|..|...+...
T Consensus 170 ~~l-~~l~~~l-----~~~~n~l~~~~~~~~~~l~--------------------------------------------- 198 (313)
T d1ogqa_ 170 GSF-SKLFTSM-----TISRNRLTGKIPPTFANLN--------------------------------------------- 198 (313)
T ss_dssp GCC-CTTCCEE-----ECCSSEEEEECCGGGGGCC---------------------------------------------
T ss_pred ccc-ccccccc-----ccccccccccccccccccc---------------------------------------------
Confidence 000 0000000 1122222322221110000
Q ss_pred HHhhhhhccccchhhhccccceeeeeecCceeEeecccchhhhhCCCccCCCCCCCchhhhcCCCCCccEEEeeCcccch
Q psy9363 259 EALHRKYVETDNELTVRENVEEVKASINAPFLELVGFDQVHEEQNTNKLPIPNDTSGVMEQIFPQGHIHTLTLGNMGYIW 338 (421)
Q Consensus 259 ~al~~~y~~~~~~~~~~~~~~~~~~~~~~~~~e~~g~~~l~~~~~L~~l~l~~~~~~~~~~~l~~~~L~~L~Ls~N~l~~ 338 (421)
...+.+.....+ +.+|..+..+ ++++.+++++|.+.
T Consensus 199 ---------------------~~~l~l~~~~~~--------------------~~~~~~~~~~--~~l~~l~~~~~~l~- 234 (313)
T d1ogqa_ 199 ---------------------LAFVDLSRNMLE--------------------GDASVLFGSD--KNTQKIHLAKNSLA- 234 (313)
T ss_dssp ---------------------CSEEECCSSEEE--------------------ECCGGGCCTT--SCCSEEECCSSEEC-
T ss_pred ---------------------cccccccccccc--------------------cccccccccc--cccccccccccccc-
Confidence 000000010000 4456677788 99999999999998
Q ss_pred hhHHHHhccCCC-cEEEccCCcCc-ccCCCCCCCCCCcEEECcCCCCCCCCcccccCcccccccccccccc-CcccCCCC
Q psy9363 339 ADILKLLANFPV-TCLKLPSNRIT-TLDSVPGMFSSLEELYLQENNIVDWGEVNALGSLPNLKYLNLASTN-LRNIKLNK 415 (421)
Q Consensus 339 ~~i~~~~~~l~~-~~L~L~~N~l~-~l~~~~~~l~~L~~L~Ls~N~l~~~~~~~~l~~l~~L~~L~Ls~N~-l~~i~~p~ 415 (421)
..++ .+..+++ +.|+|++|+|+ .+|..++.+++|+.|+|++|+|+ +. +..++.+++|+.+++++|+ +.+.|+|.
T Consensus 235 ~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~-g~-iP~~~~L~~L~~l~l~~N~~l~g~plp~ 311 (313)
T d1ogqa_ 235 FDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC-GE-IPQGGNLQRFDVSAYANNKCLCGSPLPA 311 (313)
T ss_dssp CBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEE-EE-CCCSTTGGGSCGGGTCSSSEEESTTSSC
T ss_pred cccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCccc-cc-CCCcccCCCCCHHHhCCCccccCCCCCC
Confidence 2222 3566778 99999999999 68887899999999999999995 33 3467889999999999997 78878886
Q ss_pred C
Q psy9363 416 E 416 (421)
Q Consensus 416 ~ 416 (421)
+
T Consensus 312 c 312 (313)
T d1ogqa_ 312 C 312 (313)
T ss_dssp C
T ss_pred C
Confidence 4
|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|