Diaphorina citri psyllid: psy9364


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MHVQGMVKSTHGSYKVTYHPDGPESGSPVEIDFTPPFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSDLCVKHEVECPPPRTSARLLDKLVGEFLEETCINPTFICDHPQVMSPLAKWHRDHPGLTERFELFVMKKEEVLLFPAMRPERRRTL
ccHHHHHHHHccccEEEEccccccccccEEEEcccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccEEEccccccccccccccccccccccHHHHHccccccccccccccccccccc
*HVQGMVKSTHGSYKVTYHPDGPESGSPVEIDFTPPFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSDLCVKHEVECPPPRTSARLLDKLVGEFLEETCINPTFICDHPQVMSPLAKWHRDHPGLTERFELFVMKKEEVLLFPAMRPERRRTL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHVQGMVKSTHGSYKVTYHPDGPESGSPVEIDFTPPFRRLHMFPALEAALGVKLPNPTEFDTPEANKFLSDLCVKHEVECPPPRTSARLLDKLVGEFLEETCINPTFICDHPQVMSPLAKWHRDHPGLTERFELFVMKKEEVLLFPAMRPERRRTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lysine--tRNA ligase confidentQ9ZPI1
Lysine--tRNA ligase Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.confidentQ99MN1
Lysine--tRNA ligase Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.confidentP37879

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017101 [CC]aminoacyl-tRNA synthetase multienzyme complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016597 [MF]amino acid bindingprobableGO:0043168, GO:0003674, GO:0031406, GO:0005488, GO:0043167
GO:0015966 [BP]diadenosine tetraphosphate biosynthetic processprobableGO:0044249, GO:0034641, GO:0009165, GO:0044281, GO:0015959, GO:1901362, GO:1901360, GO:0006139, GO:0044710, GO:0008150, GO:0071704, GO:0018130, GO:0009987, GO:1901576, GO:0015960, GO:0006725, GO:0015965, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:0044237, GO:0006796, GO:0006807, GO:1901293, GO:0006793, GO:0019637, GO:0019438, GO:0006753
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006430 [BP]lysyl-tRNA aminoacylationprobableGO:0006139, GO:0019752, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0034645, GO:0034660, GO:1901360, GO:0044267, GO:0044710, GO:0044260, GO:0006520, GO:0071704, GO:0010467, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0016070, GO:0044238, GO:1901564, GO:0006082, GO:0019538, GO:0044237, GO:0043170, GO:0006399, GO:0043038, GO:0043039, GO:0006418, GO:0006412
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000049 [MF]tRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BJU, chain A
Confidence level:very confident
Coverage over the Query: 2-155
View the alignment between query and template
View the model in PyMOL