Diaphorina citri psyllid: psy9365


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MPGQFTGSTEVRILTPQELAAGSQAWARKEQFVEAAPVSGGMGMHLLQKMGWQPGEGLGKNKEGTVQPLSLDIKFDRRGLVSKEELPPQRKNPYHVQQ
cccccccccccccccHHHHHcccHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccccccEEEEEcccccCEECcccccccccccccccc
*************************WARKEQFVEAAPVSGGMGMHLLQKMGWQPGEGLGKNKEGTVQPLSLDIKFDRR********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGQFTGSTEVRILTPQELAAGSQAWARKEQFVEAAPVSGGMGMHLLQKMGWQPGEGLGKNKEGTVQPLSLDIKFDRRGLVSKEELPPQRKNPYHVQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SON RNA-binding protein that acts as a mRNA splicing cofactor by promoting efficient splicing of transcripts that posses weak splice sites. Specifically promotes splicing of many cell-cycle and DNA-repair transcripts that posses weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG. Probably acts by facilitating the interaction between Serine/arginine-rich proteins such as SRSF2 and the RNA polymerase II. Also binds to DNA; binds to the consensus DNA sequence: 5'-GA[GT]AN[CG][AG]CC-3' (By similarity). May also regulate the ghrelin signaling in hypothalamic neuron by acting as a negative regulator of GHSR expression.confidentQ9QX47
Protein SON RNA-binding protein that acts as a mRNA splicing cofactor by promoting efficient splicing of transcripts that posses weak splice sites. Specifically promotes splicing of many cell-cycle and DNA-repair transcripts that posses weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG. Probably acts by facilitating the interaction between Serine/arginine-rich proteins such as SRSF2 and the RNA polymerase II. Also binds to DNA; binds to the consensus DNA sequence: 5'-GA[GT]AN[CG][AG]CC-3'. May indirectly repress hepatitis B virus (HBV) core promoter activity and transcription of HBV genes and production of HBV virions.confidentP18583

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0043484 [BP]regulation of RNA splicingprobableGO:0080090, GO:0019222, GO:0060255, GO:0051252, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0010468
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0006397 [BP]mRNA processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted