Psyllid ID: psy9377


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MLGGSKIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGNPVCLVMEYAEGGSLYNELQRSSAASLKFCKIYLPFWFSSSS
ccccccEEEcccccEEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEEEcccccHHHHHHcccccccccccHHHEEEccccc
ccccccEEEcccccEEEEEEccccEEEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEcccccHHHHHHcccccccccHHcccccHccccc
mlggskivgqGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLygactgnpvCLVMEYAEGGSLYNELQRSSAASLKFCkiylpfwfssss
MLGGSKIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGNPVCLVMEYAEGGSLYNELQRSSAASLKFCKIYLPFWFSSSS
MLGGSKIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGNPVCLVMEYAEGGSLYNELQRSSAASLKFCKIYLPFWFSSSS
******IVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGNPVCLVMEYAEGGSLYNELQRSSAASLKFCKIYLPFWF****
**GGSKIVGQGAFGVVWKGLWQNQYVAVKHIET*****AFAVEVRQLSRVSHPNIVKLYGACTGNPVCLVMEYAEGGSLYNELQRSSAASLKFCKIYLPFWFSSS*
MLGGSKIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGNPVCLVMEYAEGGSLYNELQRSSAASLKFCKIYLPFWFSSSS
*LGGSKIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGNPVCLVMEYAEGGSLYNELQRSSAASLKFCKIYLPFWF****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGGSKIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGNPVCLVMEYAEGGSLYNELQRSSAASLKFCKIYLPFWFSSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query106 2.2.26 [Sep-21-2011]
P0C8E4 606 Mitogen-activated protein yes N/A 0.735 0.128 0.734 4e-28
A2VDU3 579 Mitogen-activated protein yes N/A 0.735 0.134 0.734 5e-28
O43318 606 Mitogen-activated protein yes N/A 0.735 0.128 0.734 6e-28
Q5RFL3 606 Mitogen-activated protein yes N/A 0.735 0.128 0.734 6e-28
Q62073 579 Mitogen-activated protein yes N/A 0.735 0.134 0.734 6e-28
Q9V3Q6 678 Mitogen-activated protein yes N/A 0.726 0.113 0.5 4e-15
Q55GU0 916 Probable serine/threonine yes N/A 0.754 0.087 0.453 6e-14
P18161 1155 Dual specificity protein no N/A 0.792 0.072 0.404 7e-13
Q66L42 940 Mitogen-activated protein no N/A 0.698 0.078 0.456 4e-12
Q7T2V3 1005 Mitogen-activated protein N/A N/A 0.735 0.077 0.435 4e-12
>sp|P0C8E4|M3K7_RAT Mitogen-activated protein kinase kinase kinase 7 OS=Rattus norvegicus GN=Map3k7 PE=2 SV=1 Back     alignment and function desciption
 Score =  123 bits (308), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 1/79 (1%)

Query: 6   KIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGN 65
           ++VG+GAFGVV K  W+ + VA+K IE+E+ERKAF VE+RQLSRV+HPNIVKLYGAC  N
Sbjct: 40  EVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACL-N 98

Query: 66  PVCLVMEYAEGGSLYNELQ 84
           PVCLVMEYAEGGSLYN L 
Sbjct: 99  PVCLVMEYAEGGSLYNVLH 117




Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Plays an important role in the cascades of cellular responses evoked by changes in the environment. Mediates signal transduction of TRAF6, various cytokines including interleukin-1 (IL-1), transforming growth factor-beta (TGFB), TGFB-related factors like BMP2 and BMP4, toll-like receptors (TLR), tumor necrosis factor receptor CD40 and B-cell receptor (BCR). Ceramides are also able to activate MAP3K7/TAK1. Once activated, acts as an upstream activator of the MKK/JNK signal transduction cascade and the p38 MAPK signal transduction cascade through the phosphorylation and activation of several MAP kinase kinases like MAP2K1/MEK1, MAP2K3/MKK3, MAP2K6/MKK6 and MAP2K7/MKK7. These MAP2Ks in turn activate p38 MAPKs, c-jun N-terminal kinases (JNKs) and I-kappa-B kinase complex (IKK). Both p38 MAPK and JNK pathways control the transcription factors activator protein-1 (AP-1), while nuclear factor-kappa B is activated by IKK. MAP3K7 activates also IKBKB and MAPK8/JNK1 in response to TRAF6 signaling and mediates BMP2-induced apoptosis. In osmotic stress signaling, plays a major role in the activation of MAPK8/JNK1, but not that of NF-kappa-B.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 2EC: 5
>sp|A2VDU3|M3K7_BOVIN Mitogen-activated protein kinase kinase kinase 7 OS=Bos taurus GN=MAP3K7 PE=2 SV=1 Back     alignment and function description
>sp|O43318|M3K7_HUMAN Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens GN=MAP3K7 PE=1 SV=1 Back     alignment and function description
>sp|Q5RFL3|M3K7_PONAB Mitogen-activated protein kinase kinase kinase 7 OS=Pongo abelii GN=MAP3K7 PE=2 SV=1 Back     alignment and function description
>sp|Q62073|M3K7_MOUSE Mitogen-activated protein kinase kinase kinase 7 OS=Mus musculus GN=Map3k7 PE=1 SV=1 Back     alignment and function description
>sp|Q9V3Q6|M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster GN=Tak1 PE=2 SV=1 Back     alignment and function description
>sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 Back     alignment and function description
>sp|P18161|SPLB_DICDI Dual specificity protein kinase splB OS=Dictyostelium discoideum GN=splB PE=2 SV=2 Back     alignment and function description
>sp|Q66L42|M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus GN=Map3k10 PE=2 SV=2 Back     alignment and function description
>sp|Q7T2V3|M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis GN=map3k10 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
328704286 424 PREDICTED: mitogen-activated protein kin 0.745 0.186 0.810 6e-33
307170949 620 Mitogen-activated protein kinase kinase 0.745 0.127 0.797 3e-32
332019972 601 Mitogen-activated protein kinase kinase 0.745 0.131 0.797 3e-32
307199103 608 Mitogen-activated protein kinase kinase 0.745 0.129 0.797 3e-32
350409385 549 PREDICTED: mitogen-activated protein kin 0.745 0.143 0.772 1e-31
340713629 548 PREDICTED: mitogen-activated protein kin 0.745 0.144 0.772 1e-31
380011433 549 PREDICTED: LOW QUALITY PROTEIN: mitogen- 0.745 0.143 0.772 1e-31
328793765 548 PREDICTED: mitogen-activated protein kin 0.745 0.144 0.759 1e-31
383859401 545 PREDICTED: mitogen-activated protein kin 0.745 0.144 0.772 2e-31
156550001 533 PREDICTED: mitogen-activated protein kin 0.745 0.148 0.784 4e-31
>gi|328704286|ref|XP_001944457.2| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  144 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 64/79 (81%), Positives = 73/79 (92%)

Query: 6   KIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGN 65
           +IVG+G+FGVV++G W+N YVAVKHI+TEAERKAF VEVRQLSRV+HPNIVKLYGACT N
Sbjct: 26  EIVGKGSFGVVYRGRWRNNYVAVKHIDTEAERKAFTVEVRQLSRVNHPNIVKLYGACTSN 85

Query: 66  PVCLVMEYAEGGSLYNELQ 84
           PVCLVME+AEGGSLYN L 
Sbjct: 86  PVCLVMEFAEGGSLYNVLH 104




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307170949|gb|EFN63041.1| Mitogen-activated protein kinase kinase kinase 7 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332019972|gb|EGI60432.1| Mitogen-activated protein kinase kinase kinase 7 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307199103|gb|EFN79813.1| Mitogen-activated protein kinase kinase kinase 7 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350409385|ref|XP_003488717.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713629|ref|XP_003395343.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380011433|ref|XP_003689810.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase 7-like [Apis florea] Back     alignment and taxonomy information
>gi|328793765|ref|XP_397248.4| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Apis mellifera] Back     alignment and taxonomy information
>gi|383859401|ref|XP_003705183.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156550001|ref|XP_001604249.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
UNIPROTKB|D4A600 518 Map3k7 "Mitogen-activated prot 0.726 0.148 0.743 8.6e-26
UNIPROTKB|A2VDU3 579 MAP3K7 "Mitogen-activated prot 0.726 0.132 0.743 1.3e-25
UNIPROTKB|E2R3R9 579 MAP3K7 "Uncharacterized protei 0.726 0.132 0.743 1.3e-25
MGI|MGI:1346877 579 Map3k7 "mitogen-activated prot 0.726 0.132 0.743 1.3e-25
UNIPROTKB|D4A0S5 579 Map3k7 "Mitogen-activated prot 0.726 0.132 0.743 1.3e-25
UNIPROTKB|E2R3R6 606 MAP3K7 "Uncharacterized protei 0.726 0.127 0.743 1.5e-25
UNIPROTKB|O43318 606 MAP3K7 "Mitogen-activated prot 0.726 0.127 0.743 1.5e-25
UNIPROTKB|Q5RFL3 606 MAP3K7 "Mitogen-activated prot 0.726 0.127 0.743 1.5e-25
RGD|1309438 606 Map3k7 "mitogen activated prot 0.726 0.127 0.743 1.5e-25
UNIPROTKB|E1C063 617 MAP3K7 "Uncharacterized protei 0.726 0.124 0.743 1.6e-25
UNIPROTKB|D4A600 Map3k7 "Mitogen-activated protein kinase kinase kinase 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 297 (109.6 bits), Expect = 8.6e-26, P = 8.6e-26
 Identities = 58/78 (74%), Positives = 68/78 (87%)

Query:     6 KIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGN 65
             ++VG+GAFGVV K  W+ + VA+K IE+E+ERKAF VE+RQLSRV+HPNIVKLYGAC  N
Sbjct:    40 EVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACL-N 98

Query:    66 PVCLVMEYAEGGSLYNEL 83
             PVCLVMEYAEGGSLYN L
Sbjct:    99 PVCLVMEYAEGGSLYNVL 116




GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|A2VDU3 MAP3K7 "Mitogen-activated protein kinase kinase kinase 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3R9 MAP3K7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1346877 Map3k7 "mitogen-activated protein kinase kinase kinase 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A0S5 Map3k7 "Mitogen-activated protein kinase kinase kinase 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3R6 MAP3K7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43318 MAP3K7 "Mitogen-activated protein kinase kinase kinase 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RFL3 MAP3K7 "Mitogen-activated protein kinase kinase kinase 7" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|1309438 Map3k7 "mitogen activated protein kinase kinase kinase 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C063 MAP3K7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A2VDU3M3K7_BOVIN2, ., 7, ., 1, 1, ., 2, 50.73410.73580.1347yesN/A
Q5RFL3M3K7_PONAB2, ., 7, ., 1, 1, ., 2, 50.73410.73580.1287yesN/A
P0C8E4M3K7_RAT2, ., 7, ., 1, 1, ., 2, 50.73410.73580.1287yesN/A
O43318M3K7_HUMAN2, ., 7, ., 1, 1, ., 2, 50.73410.73580.1287yesN/A
Q62073M3K7_MOUSE2, ., 7, ., 1, 1, ., 2, 50.73410.73580.1347yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 5e-25
cd00180 215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-24
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 3e-24
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 5e-23
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 7e-23
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-22
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 5e-21
cd06627 254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 8e-19
cd06623 264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 7e-18
cd08215 258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-16
cd05059 256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 3e-16
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-16
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-15
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-14
cd05039 256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 1e-14
cd08220 256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-14
cd05040 257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 2e-14
cd05112 256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-14
cd05051 296 cd05051, PTKc_DDR, Catalytic domain of the Protein 7e-14
cd05060 257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 1e-13
cd05067 260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 3e-13
cd05034 261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 3e-13
cd05068 261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 3e-13
cd06605 265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 4e-13
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 7e-13
cd05113 256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 1e-12
cd05056 270 cd05056, PTKc_FAK, Catalytic domain of the Protein 3e-12
cd05049 280 cd05049, PTKc_Trk, Catalytic domain of the Protein 3e-12
cd05148 261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 4e-12
cd05033 266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 4e-12
cd08530 256 cd08530, STKc_CNK2-like, Catalytic domain of the P 4e-12
cd05114 256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 6e-12
cd05050 288 cd05050, PTKc_Musk, Catalytic domain of the Protei 7e-12
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 1e-11
cd05044 269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 1e-11
cd07829 282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-11
cd06612 256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-11
cd05048 283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 2e-11
cd05083 254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-11
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 3e-11
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 5e-11
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 7e-11
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 8e-11
cd05123 250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-10
cd06614 286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-10
cd06626 264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-10
cd07833 288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 2e-10
cd05055 302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 2e-10
cd08225 257 cd08225, STKc_Nek5, Catalytic domain of the Protei 3e-10
cd05106 374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 3e-10
cd06608 275 cd06608, STKc_myosinIII_like, Catalytic domain of 4e-10
cd05085 250 cd05085, PTKc_Fer, Catalytic domain of the Protein 5e-10
cd05053 293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 7e-10
cd05070 260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 7e-10
cd05084 252 cd05084, PTKc_Fes, Catalytic domain of the Protein 9e-10
cd06917 277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 9e-10
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 1e-09
cd06631 265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-09
cd05066 267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 1e-09
cd05096 304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 3e-09
cd07845 309 cd07845, STKc_CDK10, Catalytic domain of the Serin 3e-09
cd08221 256 cd08221, STKc_Nek9, Catalytic domain of the Protei 3e-09
cd06613 262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 3e-09
cd05095 296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 4e-09
cd05097 295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 5e-09
cd05065 269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 5e-09
cd05071 262 cd05071, PTKc_Src, Catalytic domain of the Protein 5e-09
cd05037 259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 7e-09
cd05104 375 cd05104, PTKc_Kit, Catalytic domain of the Protein 8e-09
cd06632 258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 9e-09
cd06625 263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 1e-08
cd08217 265 cd08217, STKc_Nek2, Catalytic domain of the Protei 1e-08
cd06610 267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-08
cd07841 298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-08
cd05069 260 cd05069, PTKc_Yes, Catalytic domain of the Protein 2e-08
cd05046 275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 2e-08
cd07836 284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-08
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 3e-08
cd06611 280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 3e-08
cd06609 274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 3e-08
cd05118 283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-08
cd07838 287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 3e-08
cd05036 277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 4e-08
cd05092 280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 4e-08
cd07865 310 cd07865, STKc_CDK9, Catalytic domain of the Serine 4e-08
cd05111 279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 4e-08
cd05107 401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 4e-08
cd07843 293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 5e-08
cd05052 263 cd05052, PTKc_Abl, Catalytic domain of the Protein 5e-08
cd07832 286 cd07832, STKc_CCRK, Catalytic domain of the Serine 7e-08
cd05094 291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 7e-08
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 8e-08
cd05032 277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 9e-08
cd05054 337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 2e-07
cd08529 256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 2e-07
cd05082 256 cd05082, PTKc_Csk, Catalytic domain of the Protein 3e-07
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 3e-07
cd05063 268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 3e-07
cd05105 400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 4e-07
cd05093 288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 4e-07
cd06640 277 cd06640, STKc_MST4, Catalytic domain of the Protei 5e-07
cd05091 283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 8e-07
cd05110 303 cd05110, PTKc_HER4, Catalytic domain of the Protei 9e-07
cd05116 257 cd05116, PTKc_Syk, Catalytic domain of the Protein 9e-07
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 1e-06
cd08224 267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-06
cd06652 265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 2e-06
cd06642 277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 2e-06
cd05072 261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-06
cd07861 285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 2e-06
cd05098 307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 2e-06
cd05090 283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 3e-06
cd06636 282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 3e-06
cd05594 325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 4e-06
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 4e-06
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 4e-06
cd05081 284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 5e-06
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 5e-06
cd08223 257 cd08223, STKc_Nek4, Catalytic domain of the Protei 6e-06
cd06624 268 cd06624, STKc_ASK, Catalytic domain of the Protein 6e-06
cd07835 283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 7e-06
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 7e-06
cd05115 257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 7e-06
cd05102 338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 8e-06
cd05103 343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 8e-06
cd06644 292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 8e-06
cd06643 282 cd06643, STKc_SLK, Catalytic domain of the Protein 9e-06
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 1e-05
COG2112201 COG2112, COG2112, Predicted Ser/Thr protein kinase 1e-05
cd05064 266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 1e-05
cd06641 277 cd06641, STKc_MST3, Catalytic domain of the Protei 1e-05
cd05042 269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 1e-05
cd07866 311 cd07866, STKc_BUR1, Catalytic domain of the Serine 2e-05
cd05075 272 cd05075, PTKc_Axl, Catalytic domain of the Protein 2e-05
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 2e-05
cd05079 284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 2e-05
cd05047 270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 2e-05
cd07864 302 cd07864, STKc_CDK12, Catalytic domain of the Serin 3e-05
cd08218 256 cd08218, STKc_Nek1, Catalytic domain of the Protei 3e-05
cd06616 288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 3e-05
cd06622 286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 3e-05
cd06628 267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-05
cd05089 297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 3e-05
cd05073 260 cd05073, PTKc_Hck, Catalytic domain of the Protein 3e-05
cd06621 287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 3e-05
cd07862 290 cd07862, STKc_CDK6, Catalytic domain of the Serine 4e-05
cd06648 285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 4e-05
cd07847 286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 5e-05
cd05088 303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 6e-05
cd05578 258 cd05578, STKc_Yank1, Catalytic domain of the Prote 6e-05
cd06653 264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 8e-05
cd07842 316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 8e-05
cd06629 272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 9e-05
cd07860 284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 1e-04
cd05035 273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 1e-04
cd05101 304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 1e-04
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 1e-04
cd06651 266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 1e-04
cd06637 272 cd06637, STKc_TNIK, Catalytic domain of the Protei 1e-04
cd06655 296 cd06655, STKc_PAK2, Catalytic domain of the Protei 1e-04
cd08222 260 cd08222, STKc_Nek11, Catalytic domain of the Prote 1e-04
cd05058 262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 1e-04
cd06656 297 cd06656, STKc_PAK3, Catalytic domain of the Protei 2e-04
cd05100 334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 2e-04
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 3e-04
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 3e-04
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 3e-04
cd06630 268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 3e-04
cd07849 336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 4e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-04
cd06647 293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 4e-04
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 4e-04
cd05099 314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 4e-04
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 4e-04
cd05087 269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 4e-04
cd07863 288 cd07863, STKc_CDK4, Catalytic domain of the Serine 5e-04
cd05109 279 cd05109, PTKc_HER2, Catalytic domain of the Protei 7e-04
cd05080 283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 7e-04
cd07855 334 cd07855, STKc_ERK5, Catalytic domain of the Serine 7e-04
PLN00009 294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 7e-04
PLN00034 353 PLN00034, PLN00034, mitogen-activated protein kina 8e-04
cd08219 255 cd08219, STKc_Nek3, Catalytic domain of the Protei 8e-04
cd08528 269 cd08528, STKc_Nek10, Catalytic domain of the Prote 0.001
cd05609 305 cd05609, STKc_MAST, Catalytic domain of the Protei 0.001
cd06654 296 cd06654, STKc_PAK1, Catalytic domain of the Protei 0.001
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 0.001
cd06607 307 cd06607, STKc_TAO, Catalytic domain of the Protein 0.001
cd05061 288 cd05061, PTKc_InsR, Catalytic domain of the Protei 0.001
cd06638 286 cd06638, STKc_myosinIIIA, Catalytic domain of the 0.002
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 0.002
cd06657 292 cd06657, STKc_PAK4, Catalytic domain of the Protei 0.002
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 0.002
cd08228 267 cd08228, STKc_Nek6, Catalytic domain of the Protei 0.002
cd06634 308 cd06634, STKc_TAO2, Catalytic domain of the Protei 0.002
cd05611 260 cd05611, STKc_Rim15_like, Catalytic domain of fung 0.002
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 0.002
cd07839 284 cd07839, STKc_CDK5, Catalytic domain of the Serine 0.002
cd08229 267 cd08229, STKc_Nek7, Catalytic domain of the Protei 0.003
cd05062 277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 0.003
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 0.003
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 0.004
cd06658 292 cd06658, STKc_PAK5, Catalytic domain of the Protei 0.004
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
 Score = 94.1 bits (235), Expect = 5e-25
 Identities = 37/90 (41%), Positives = 51/90 (56%), Gaps = 10/90 (11%)

Query: 6  KIVGQGAFGVVWKGLW------QNQYVAVK---HIETEAERKAFAVEVRQLSRVSHPNIV 56
          K +G+GAFG V+KG            VAVK      +E ER+ F  E   + ++SHPNIV
Sbjct: 5  KKLGEGAFGEVYKGTLKGDGEGTETKVAVKTLKEGASEEEREEFLEEASIMKKLSHPNIV 64

Query: 57 KLYGACT-GNPVCLVMEYAEGGSLYNELQR 85
          +L G CT G P+ +V EY  GG L + L++
Sbjct: 65 RLLGVCTQGEPLYIVTEYMPGGDLLDFLRK 94


Length = 258

>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|225023 COG2112, COG2112, Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 106
KOG0595|consensus 429 99.92
KOG0575|consensus 592 99.88
KOG0615|consensus 475 99.86
KOG0611|consensus 668 99.83
KOG0605|consensus 550 99.82
KOG0600|consensus 560 99.82
KOG0583|consensus 370 99.82
KOG0616|consensus 355 99.8
KOG0598|consensus 357 99.79
KOG0588|consensus 786 99.78
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.77
KOG0581|consensus 364 99.77
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.76
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.76
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.76
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.76
KOG0597|consensus 808 99.76
KOG0192|consensus 362 99.75
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.75
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.74
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.74
KOG0593|consensus 396 99.74
KOG0586|consensus 596 99.74
KOG0032|consensus 382 99.73
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.73
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.72
KOG0197|consensus 468 99.72
KOG0592|consensus 604 99.72
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.72
KOG0663|consensus 419 99.72
KOG0580|consensus 281 99.71
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.71
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.71
KOG0610|consensus 459 99.7
KOG0194|consensus 474 99.7
KOG0659|consensus 318 99.7
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.7
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.7
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.7
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.7
KOG0591|consensus 375 99.7
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.69
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.69
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.69
KOG0661|consensus 538 99.69
KOG0033|consensus 355 99.69
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.68
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.68
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.68
KOG4717|consensus 864 99.68
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.68
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.67
KOG1187|consensus 361 99.67
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.67
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.67
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.67
KOG0198|consensus 313 99.67
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.67
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.67
KOG0589|consensus 426 99.66
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.66
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.66
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.65
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.65
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.65
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.65
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.65
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.65
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.64
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.64
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.64
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.64
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.64
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.63
KOG1094|consensus 807 99.63
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.63
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.63
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.63
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.63
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.63
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.63
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.63
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.63
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.63
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.62
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.62
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.62
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.62
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.62
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.62
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.62
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.62
KOG4236|consensus 888 99.62
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.62
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.62
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.62
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.62
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 99.62
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.62
KOG0667|consensus 586 99.62
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.62
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.61
PHA02988 283 hypothetical protein; Provisional 99.61
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.61
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.61
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.61
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.61
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.61
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.61
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.61
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.6
KOG0585|consensus 576 99.6
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.6
PTZ00267 478 NIMA-related protein kinase; Provisional 99.6
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.6
KOG0584|consensus 632 99.6
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.6
KOG0574|consensus 502 99.6
KOG0582|consensus 516 99.6
KOG1026|consensus 774 99.6
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.6
KOG0612|consensus 1317 99.6
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.6
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.6
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.59
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.59
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.59
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.59
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.59
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.59
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.59
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.59
KOG0662|consensus 292 99.59
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.59
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.58
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.58
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.58
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 99.58
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.58
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.58
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.58
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.58
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.58
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.58
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.58
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.58
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.58
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.58
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.58
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.57
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.57
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.57
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.57
PHA03212 391 serine/threonine kinase US3; Provisional 99.57
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.57
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.57
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.57
KOG0201|consensus 467 99.57
KOG0599|consensus 411 99.57
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.57
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.57
KOG0660|consensus 359 99.57
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.57
KOG4257|consensus 974 99.57
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.57
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.57
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.57
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.56
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.56
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.56
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.56
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.56
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.56
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.56
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.56
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.56
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.56
KOG0694|consensus 694 99.56
KOG0594|consensus 323 99.56
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.55
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.55
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.55
KOG1095|consensus 1025 99.55
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 99.55
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.55
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.55
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.55
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.55
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.55
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.55
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.55
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.55
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.55
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.55
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.55
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.55
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.55
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.54
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.54
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.54
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.54
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.54
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.54
KOG1989|consensus 738 99.54
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.54
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.54
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.54
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.54
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.54
KOG1151|consensus 775 99.54
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.54
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.54
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.53
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.53
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.53
KOG0658|consensus 364 99.53
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.53
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.53
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.53
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.53
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.53
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.53
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.53
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.53
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.53
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.53
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.53
KOG0196|consensus 996 99.53
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.52
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.52
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 99.52
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.52
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.52
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.52
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.52
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.52
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.52
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.52
KOG4250|consensus 732 99.52
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.51
KOG0578|consensus 550 99.51
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.51
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.51
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.51
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.51
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.51
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.51
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.51
PTZ00283 496 serine/threonine protein kinase; Provisional 99.51
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.51
KOG2052|consensus 513 99.5
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.5
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.5
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.5
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.5
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.5
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.5
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 99.49
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.49
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.49
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.49
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.49
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.49
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 99.49
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.48
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.48
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 99.48
KOG0690|consensus 516 99.48
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.48
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.48
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.48
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.48
KOG4278|consensus 1157 99.48
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.48
KOG0199|consensus 1039 99.47
PHA03207 392 serine/threonine kinase US3; Provisional 99.47
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.47
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.47
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.47
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.47
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.47
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.47
KOG0193|consensus 678 99.47
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.46
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.46
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.46
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.46
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.46
KOG4721|consensus 904 99.46
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.46
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.46
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.46
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.46
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.46
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.45
PTZ00036 440 glycogen synthase kinase; Provisional 99.45
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.45
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.45
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.45
PTZ00284 467 protein kinase; Provisional 99.45
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.45
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.45
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.45
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.45
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.45
PLN00009 294 cyclin-dependent kinase A; Provisional 99.44
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.44
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.44
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.44
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 99.44
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.44
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.44
KOG0607|consensus 463 99.44
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.43
KOG0666|consensus 438 99.43
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.43
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.43
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.43
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.43
KOG1290|consensus 590 99.43
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.43
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.42
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.42
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.42
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.41
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.41
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.41
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.41
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.41
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.41
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.41
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.41
PHA03209 357 serine/threonine kinase US3; Provisional 99.41
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.41
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.4
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.4
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.4
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.4
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.4
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.39
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.39
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.38
KOG0608|consensus 1034 99.38
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.38
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.37
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.37
PHA03211 461 serine/threonine kinase US3; Provisional 99.37
KOG3653|consensus 534 99.37
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.37
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.36
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.35
KOG1152|consensus772 99.35
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.35
KOG1025|consensus 1177 99.35
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.34
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.34
smart00221 225 STYKc Protein kinase; unclassified specificity. Ph 99.34
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.34
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.33
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 99.31
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.31
KOG0579|consensus 1187 99.31
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.31
KOG0577|consensus 948 99.29
KOG0587|consensus 953 99.29
KOG4645|consensus 1509 99.28
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.28
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.27
PRK09188 365 serine/threonine protein kinase; Provisional 99.27
KOG4279|consensus 1226 99.25
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.24
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.24
cd00180 215 PKc Catalytic domain of Protein Kinases. Protein K 99.24
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 99.24
KOG0604|consensus 400 99.22
KOG0576|consensus 829 99.22
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 99.21
KOG2345|consensus 302 99.21
PHA03210 501 serine/threonine kinase US3; Provisional 99.19
KOG0671|consensus 415 99.18
PRK10345210 hypothetical protein; Provisional 99.17
KOG0695|consensus 593 99.16
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.15
KOG0696|consensus 683 99.15
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.14
KOG0668|consensus 338 99.13
KOG0669|consensus 376 99.08
KOG0596|consensus 677 99.07
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 99.05
KOG0200|consensus 609 99.02
smart00090237 RIO RIO-like kinase. 99.01
KOG0986|consensus 591 99.0
KOG1345|consensus 378 98.99
PRK14879211 serine/threonine protein kinase; Provisional 98.98
KOG1167|consensus 418 98.95
PLN03224 507 probable serine/threonine protein kinase; Provisio 98.91
KOG0614|consensus 732 98.91
KOG0670|consensus 752 98.85
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.82
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.81
KOG0603|consensus 612 98.8
KOG1035|consensus 1351 98.77
KOG1163|consensus 341 98.73
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 98.73
KOG1027|consensus 903 98.66
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.64
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 98.63
PHA02882 294 putative serine/threonine kinase; Provisional 98.58
KOG0664|consensus 449 98.53
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.47
KOG1164|consensus 322 98.41
COG0515 384 SPS1 Serine/threonine protein kinase [General func 98.41
KOG1006|consensus 361 98.36
KOG1165|consensus 449 98.34
KOG0195|consensus 448 98.32
PRK12274 218 serine/threonine protein kinase; Provisional 98.22
KOG0983|consensus 391 98.2
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 98.18
KOG1166|consensus 974 98.13
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 98.07
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.05
KOG0984|consensus 282 97.95
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.94
cd05154 223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 97.69
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 97.63
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 97.56
KOG1024|consensus 563 97.49
KOG0665|consensus 369 97.41
KOG3741|consensus 655 97.08
KOG1243|consensus 690 96.69
KOG0590|consensus 601 96.57
KOG0590|consensus 601 96.53
KOG1240|consensus 1431 96.36
PF01636 239 APH: Phosphotransferase enzyme family This family 96.35
COG0661 517 AarF Predicted unusual protein kinase [General fun 96.12
PRK10593 297 hypothetical protein; Provisional 96.07
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 95.79
KOG3087|consensus 229 95.52
KOG0603|consensus 612 95.23
KOG1266|consensus 458 95.05
KOG1023|consensus 484 94.94
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 94.65
KOG1235|consensus 538 94.45
KOG0601|consensus 524 94.36
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 93.33
TIGR02172 226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 93.11
PLN02876 822 acyl-CoA dehydrogenase 92.39
cd05150 244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 92.29
KOG0601|consensus 524 91.42
COG0478304 RIO-like serine/threonine protein kinase fused to 91.37
KOG4158|consensus 598 90.48
KOG2270|consensus 520 89.25
PLN00181 793 protein SPA1-RELATED; Provisional 89.08
PF03881 288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 88.37
COG3001 286 Uncharacterized protein conserved in bacteria [Fun 88.22
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 84.55
PRK15123 268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 84.18
KOG1035|consensus 1351 82.45
PRK09550 401 mtnK methylthioribose kinase; Reviewed 82.36
>KOG0595|consensus Back     alignment and domain information
Probab=99.92  E-value=7.2e-25  Score=133.97  Aligned_cols=104  Identities=29%  Similarity=0.457  Sum_probs=93.6

Q ss_pred             CCCceeEeecCcceEEEEEEC--CceEEEEEecCH----HHHHHHHHHHHHHhcCCCCceeeeeeeE-ecCceEEEEeec
Q psy9377           2 LGGSKIVGQGAFGVVWKGLWQ--NQYVAVKHIETE----AERKAFAVEVRQLSRVSHPNIVKLYGAC-TGNPVCLVMEYA   74 (106)
Q Consensus         2 ~~~~~~lg~g~~~~v~~~~~~--~~~~~~k~~~~~----~~~~~~~~~~~~~~~~~~~~i~~~~~~~-~~~~~~lv~e~~   74 (106)
                      |...+.||.|+|+.||++.++  +..+++|.+...    ...+.+..|+.+++.++|+||+.+.+.+ .++.+++|||||
T Consensus        12 y~~~~~iG~GsfavVykg~h~~~~~~VAIK~i~~~~l~~k~~e~L~~Ei~iLkel~H~nIV~l~d~~~~~~~i~lVMEyC   91 (429)
T KOG0595|consen   12 YELSREIGSGSFAVVYKGRHKKSGTEVAIKCIAKKKLNKKLVELLLSEIKILKELKHPNIVRLLDCIEDDDFIYLVMEYC   91 (429)
T ss_pred             ceehhhccCcceEEEEEeEeccCCceEEeeeehhhccCHHHHHHHHHHHHHHHhcCCcceeeEEEEEecCCeEEEEEEeC
Confidence            677788999999999999887  788999998633    3566788999999999999999999999 568899999999


Q ss_pred             CCCChHHHHhcCCCCchhhhhhhhhccccCC
Q psy9377          75 EGGSLYNELQRSSAASLKFCKIYLPFWFSSS  105 (106)
Q Consensus        75 ~~g~l~~~l~~~~~~~~~~~~~~~~qll~~~  105 (106)
                      .||+|.+|+++.+.++++.++.+|+||..|+
T Consensus        92 ~gGDLs~yi~~~~~l~e~t~r~Fm~QLA~al  122 (429)
T KOG0595|consen   92 NGGDLSDYIRRRGRLPEATARHFMQQLASAL  122 (429)
T ss_pred             CCCCHHHHHHHcCCCCHHHHHHHHHHHHHHH
Confidence            9999999999998899999999999998775



>KOG0575|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG3741|consensus Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>KOG1235|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG2270|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
2eva_A 307 Structural Basis For The Interaction Of Tak1 Kinase 7e-28
4gs6_A 315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 7e-28
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 1e-10
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 1e-10
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 1e-10
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 8e-10
3sxr_A 268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 8e-10
3qgw_A 286 Crystal Structure Of Itk Kinase Bound To An Inhibit 2e-09
3miy_A 266 X-Ray Crystal Structure Of Itk Complexed With Sunit 2e-09
1sm2_A 264 Crystal Structure Of The Phosphorylated Interleukin 2e-09
3v5j_A 266 Crystal Structure Of Interleukin-2 Inducible T-Cell 3e-09
4hct_A 269 Crystal Structure Of Itk In Complex With Compound 5 3e-09
3t9t_A 267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 3e-09
3p86_A 309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 4e-09
3ppz_A 309 Crystal Structure Of Ctr1 Kinase Domain In Complex 5e-09
3dtc_A 271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 7e-09
3p08_A 267 Crystal Structure Of The Human Btk Kinase Domain Le 8e-09
3ocs_A 271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 8e-09
1k2p_A 263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 8e-09
3oct_A 265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 8e-09
3pix_A 274 Crystal Structure Of Btk Kinase Domain Complexed Wi 8e-09
3gen_A 283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 8e-09
3k54_A 283 Structures Of Human Bruton's Tyrosine Kinase In Act 9e-09
4f1m_A 287 Crystal Structure Of The G1179s Roco4 Kinase Domain 2e-08
4f0f_A 287 Crystal Structure Of The Roco4 Kinase Domain Bound 2e-08
4f1o_A 287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 2e-08
2dq7_X 283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 3e-08
2og8_A 265 Crystal Structure Of Aminoquinazoline 36 Bound To L 5e-08
3mpm_A 267 Lck Complexed With A Pyrazolopyrimidine Length = 26 5e-08
1b6c_B 342 Crystal Structure Of The Cytoplasmic Domain Of The 5e-08
3bys_A 277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 5e-08
3lck_A 271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 5e-08
2of2_A 271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 5e-08
3bym_A 272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 5e-08
2ofv_A 277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 5e-08
2ofu_A 273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 6e-08
3kmm_A 288 Structure Of Human Lck Kinase With A Small Molecule 6e-08
1qpe_A 279 Structural Analysis Of The Lymphocyte-Specific Kina 6e-08
2pl0_A 289 Lck Bound To Imatinib Length = 289 6e-08
3kxz_A 287 The Complex Crystal Structure Of Lck With A Probe M 6e-08
2ivv_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 6e-08
2zm1_A 285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 6e-08
1py5_A 326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 6e-08
2ivt_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 6e-08
2ivs_A 314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 6e-08
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 8e-08
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 8e-08
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 8e-08
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 8e-08
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 8e-08
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 8e-08
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 8e-08
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 8e-08
3bkb_A 377 Crystal Structure Of Human Feline Sarcoma Viral Onc 8e-08
1yi6_A 276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 8e-08
2j0l_A 276 Crystal Structure Of A The Active Conformation Of T 9e-08
3cd3_A 377 Crystal Structure Of Phosphorylated Human Feline Sa 9e-08
4ebw_A 304 Structure Of Focal Adhesion Kinase Catalytic Domain 9e-08
2jkk_A 276 Focal Adhesion Kinase Catalytic Domain In Complex W 9e-08
2j0m_B 276 Crystal Structure A Two-Chain Complex Between The F 9e-08
1mp8_A 281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 9e-08
2jkm_A 276 Focal Adhesion Kinase Catalytic Domain In Complex W 9e-08
1fmk_A 452 Crystal Structure Of Human Tyrosine-Protein Kinase 1e-07
1yol_A 283 Crystal Structure Of Src Kinase Domain In Complex W 1e-07
3bz3_A 276 Crystal Structure Analysis Of Focal Adhesion Kinase 1e-07
1yoj_A 283 Crystal Structure Of Src Kinase Domain Length = 283 1e-07
3pxk_A 282 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-07
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 1e-07
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 1e-07
1y57_A 452 Structure Of Unphosphorylated C-Src In Complex With 1e-07
2etm_A 281 Crystal Structure Of Focal Adhesion Kinase Domain C 1e-07
2bdf_A 279 Src Kinase In Complex With Inhibitor Ap23451 Length 1e-07
2h8h_A 535 Src Kinase In Complex With A Quinazoline Inhibitor 1e-07
3oez_A 286 Crystal Structure Of The L317i Mutant Of The Chicke 1e-07
3dqw_A 286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 1e-07
3g6h_A 286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 1e-07
2j0j_A 656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-07
2j0k_A 656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-07
3og7_A 289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-07
2qq7_A 286 Crystal Structure Of Drug Resistant Src Kinase Doma 2e-07
2ptk_A 453 Chicken Src Tyrosine Kinase Length = 453 2e-07
1ksw_A 452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 2e-07
1uwh_A 276 The Complex Of Wild Type B-Raf And Bay439006 Length 2e-07
2wot_A 306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 2e-07
1rw8_A 301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 2e-07
3tzm_A 309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 2e-07
1vjy_A 303 Crystal Structure Of A Naphthyridine Inhibitor Of H 2e-07
3d7u_B 277 Structural Basis For The Recognition Of C-Src By It 2e-07
1luf_A 343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 2e-07
3lcd_A 329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 2e-07
3c4c_A 280 B-Raf Kinase In Complex With Plx4720 Length = 280 2e-07
3omv_A 307 Crystal Structure Of C-Raf (Raf-1) Length = 307 2e-07
3geq_A 286 Structural Basis For The Chemical Rescue Of Src Kin 2e-07
4fk3_A 292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-07
3u4w_A 275 Src In Complex With Dna-Templated Macrocyclic Inhib 2e-07
2oiq_A 286 Crystal Structure Of Chicken C-Src Kinase Domain In 2e-07
2ogv_A 317 Crystal Structure Of The Autoinhibited Human C-Fms 2e-07
3q96_A 282 B-Raf Kinase Domain In Complex With A Tetrahydronap 3e-07
2fb8_A 281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 3e-07
4dbn_A 284 Crystal Structure Of The Kinase Domain Of Human B-R 3e-07
3ii5_A 306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 3e-07
3idp_A 300 B-Raf V600e Kinase Domain In Complex With An Aminoi 3e-07
3d4q_A 307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 3e-07
4g9r_A 307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 3e-07
4h58_A 275 Braf In Complex With Compound 3 Length = 275 3e-07
1uwj_A 276 The Complex Of Mutant V599e B-raf And Bay439006 Len 3e-07
3svv_A 286 Crystal Structure Of T338c C-Src Covalently Bound T 4e-07
3lmg_A 344 Crystal Structure Of The Erbb3 Kinase Domain In Com 4e-07
3h9r_A 330 Crystal Structure Of The Kinase Domain Of Type I Ac 4e-07
3lco_A 324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 4e-07
3my0_A 305 Crystal Structure Of The Acvrl1 (Alk1) Kinase Domai 4e-07
2rei_A 318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 4e-07
3kex_A 325 Crystal Structure Of The Catalytically Inactive Kin 4e-07
1qpd_A 279 Structural Analysis Of The Lymphocyte-specific Kina 6e-07
3mtf_A 301 Crystal Structure Of The Acvr1 Kinase In Complex Wi 7e-07
4dym_A 301 Crystal Structure Of The Acvr1 Kinase Domain In Com 7e-07
3v5q_A 297 Discovery Of A Selective Trk Inhibitor With Efficac 7e-07
2r2p_A 295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 7e-07
2i0v_A 335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 7e-07
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 8e-07
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 8e-07
3c4f_A 302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 8e-07
1jpa_A 312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 9e-07
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 9e-07
2hwo_A 286 Crystal Structure Of Src Kinase Domain In Complex W 1e-06
3bea_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 1e-06
2i1m_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 1e-06
2hen_A 286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 1e-06
1t46_A 313 Structural Basis For The Autoinhibition And Sti-571 1e-06
3mdy_A 337 Crystal Structure Of The Cytoplasmic Domain Of The 1e-06
3hng_A 360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 2e-06
3cc6_A 281 Crystal Structure Of Kinase Domain Of Protein Tyros 2e-06
4h1j_A 293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 2e-06
1pkg_A 329 Structure Of A C-kit Kinase Product Complex Length 2e-06
3fzo_A 277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 2e-06
2hel_A 306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 2e-06
2xyu_A 285 Crystal Structure Of Epha4 Kinase Domain In Complex 2e-06
3dk6_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-06
2vwu_A 302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 2e-06
4asz_A 299 Crystal Structure Of Apo Trkb Kinase Domain Length 2e-06
1t45_A 331 Structural Basis For The Autoinhibition And Sti-571 2e-06
2y6m_A 291 Crystal Structure Of Epha4 Kinase Domain Length = 2 3e-06
3g0e_A 336 Kit Kinase Domain In Complex With Sunitinib Length 3e-06
3hko_A 345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 3e-06
4aw5_A 291 Complex Of The Ephb4 Kinase Domain With An Oxindole 3e-06
3g0f_A 336 Kit Kinase Domain Mutant D816h In Complex With Suni 3e-06
2y4i_B 319 Ksr2-Mek1 Heterodimer Length = 319 3e-06
1rjb_A 344 Crystal Structure Of Flt3 Length = 344 3e-06
3gql_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 3e-06
4ewh_B 275 Co-Crystal Structure Of Ack1 With Inhibitor Length 3e-06
1u54_A 291 Crystal Structures Of The Phosphorylated And Unphos 3e-06
1byg_A 278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 3e-06
4id7_A 273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 3e-06
3kmw_A 271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 3e-06
3eqp_B 276 Crystal Structure Of Ack1 With Compound T95 Length 3e-06
4hzr_A 277 Crystal Structure Of Ack1 Kinase Domain Length = 27 3e-06
1u46_A 291 Crystal Structure Of The Unphosphorylated Kinase Do 3e-06
3d7t_A 269 Structural Basis For The Recognition Of C-Src By It 3e-06
3dk7_A 277 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-06
3d7u_A 263 Structural Basis For The Recognition Of C-Src By It 4e-06
3kmu_A 271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 4e-06
3oy3_A 284 Crystal Structure Of Abl T315i Mutant Kinase Domain 4e-06
3qrj_A 277 The Crystal Structure Of Human Abl1 Kinase Domain T 4e-06
2v7a_A 286 Crystal Structure Of The T315i Abl Mutant In Comple 4e-06
2z60_A 288 Crystal Structure Of The T315i Mutant Of Abl Kinase 4e-06
1k9a_A 450 Crystal Structure Analysis Of Full-Length Carboxyl- 4e-06
1mqb_A 333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 5e-06
3gvu_A 292 The Crystal Structure Of Human Abl2 In Complex With 5e-06
4gt4_A 308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 5e-06
3zzw_A 289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 5e-06
1fpu_A 293 Crystal Structure Of Abl Kinase Domain In Complex W 6e-06
3dk3_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 6e-06
2f4j_A 287 Structure Of The Kinase Domain Of An Imatinib-Resis 6e-06
2gqg_A 278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 6e-06
3qri_A 277 The Crystal Structure Of Human Abl1 Kinase Domain I 6e-06
2e2b_A 293 Crystal Structure Of The C-Abl Kinase Domain In Com 6e-06
3oxz_A 284 Crystal Structure Of Abl Kinase Domain Bound With A 6e-06
3pyy_A 298 Discovery And Characterization Of A Cell-Permeable, 6e-06
2g2f_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 6e-06
2hyy_A 273 Human Abl Kinase Domain In Complex With Imatinib (S 6e-06
2hzi_A 277 Abl Kinase Domain In Complex With Pd180970 Length = 6e-06
2hiw_A 287 Crystal Structure Of Inactive Conformation Abl Kina 6e-06
2g1t_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 6e-06
2qoh_A 288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 7e-06
2hz0_A 270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 7e-06
1opk_A 495 Structural Basis For The Auto-Inhibition Of C-Abl T 8e-06
3kxx_A 317 Structure Of The Mutant Fibroblast Growth Factor Re 8e-06
3js2_A 317 Crystal Structure Of Minimal Kinase Domain Of Fibro 1e-05
1fgk_A 310 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-05
4hzs_A 341 Crystal Structure Of Ack1 Kinase Domain With C-term 1e-05
4f63_A 309 Crystal Structure Of Human Fibroblast Growth Factor 1e-05
3rhx_B 306 Crystal Structure Of The Catalytic Domain Of Fgfr1 1e-05
1opl_A 537 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-05
2fo0_A 495 Organization Of The Sh3-Sh2 Unit In Active And Inac 1e-05
3fpq_A 290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 1e-05
2r4b_A 321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 1e-05
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 1e-05
3gqi_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-05
2jiv_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-05
2jit_A 327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-05
4i1z_A 329 Crystal Structure Of The Monomeric (v948r) Form Of 2e-05
2jiu_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-05
3w2o_A 331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 2e-05
4g5p_A 330 Crystal Structure Of Egfr Kinase T790m In Complex W 2e-05
4i24_A 329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 2e-05
4i21_A 329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 2e-05
3ika_A 331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 2e-05
3a4o_X 286 Lyn Kinase Domain Length = 286 2e-05
1gzk_A 315 Molecular Mechanism For The Regulation Of Protein K 2e-05
4af3_A 292 Human Aurora B Kinase In Complex With Incenp And Vx 2e-05
4a4x_A 279 Nek2-Ede Bound To Cct248662 Length = 279 2e-05
2w5a_A 279 Human Nek2 Kinase Adp-Bound Length = 279 2e-05
2jav_A 279 Human Kinase With Pyrrole-Indolinone Ligand Length 2e-05
2pk9_A 317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 2e-05
3udb_A 317 Crystal Structure Of Snrk2.6 Length = 317 3e-05
2hk5_A 270 Hck Kinase In Complex With Lck Targetted Inhibitor 3e-05
3iec_A 319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 3e-05
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 3e-05
1zmw_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-05
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-05
3coh_A 268 Crystal Structure Of Aurora-A In Complex With A Pen 4e-05
3tt0_A 382 Co-Structure Of Fibroblast Growth Factor Receptor 1 4e-05
2zv7_A 279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 4e-05
3uc4_A 362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 4e-05
3kul_B 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 5e-05
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 5e-05
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 5e-05
1o6k_A 336 Structure Of Activated Form Of Pkb Kinase Domain S4 5e-05
3e87_A 335 Crystal Structures Of The Kinase Domain Of Akt2 In 5e-05
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 5e-05
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 5e-05
3kul_A 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 5e-05
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 5e-05
4ejn_A 446 Crystal Structure Of Autoinhibited Form Of Akt1 In 5e-05
3o96_A 446 Crystal Structure Of Human Akt1 With An Allosteric 5e-05
3ocb_A 341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 5e-05
3cqu_A 342 Crystal Structure Of Akt-1 Complexed With Substrate 5e-05
3ugc_A 295 Structural Basis Of Jak2 Inhibition By The Type Ii 5e-05
3rvg_A 303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 6e-05
3com_A 314 Crystal Structure Of Mst1 Kinase Length = 314 6e-05
3lpb_A 295 Crystal Structure Of Jak2 Complexed With A Potent 2 6e-05
3e62_A 293 Fragment Based Discovery Of Jak-2 Inhibitors Length 6e-05
4e4m_A 302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 6e-05
3tjc_A 298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 6e-05
3q32_A 301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 6e-05
4hge_A 300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 6e-05
4aqc_A 301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 6e-05
2b7a_A 293 The Structural Basis Of Janus Kinase 2 Inhibition B 6e-05
4bbe_A 298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 6e-05
3jy9_A 311 Janus Kinase 2 Inhibitors Length = 311 6e-05
3io7_A 313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 6e-05
3ma6_A 298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 7e-05
2wzj_A 327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 7e-05
1zmv_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 7e-05
3daj_A 272 Crystal Structure Of Aurora A Complexed With An Inh 7e-05
3d14_A 272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 7e-05
3cjf_A 309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 7e-05
1ad5_A 438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 7e-05
3cjg_A 309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 7e-05
1qcf_A 454 Crystal Structure Of Hck In Complex With A Src Fami 7e-05
2oo8_X 317 Synthesis, Structural Analysis, And Sar Studies Of 8e-05
3bel_A 315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 8e-05
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 9e-05
2x4f_A 373 The Crystal Structure Of The Human Myosin Light Cha 9e-05
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 9e-05
3r21_A 271 Design, Synthesis, And Biological Evaluation Of Pyr 9e-05
2xa4_A 298 Inhibitors Of Jak2 Kinase Domain Length = 298 9e-05
2jfm_A 325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 9e-05
2jfl_A 325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 9e-05
2j51_A 325 Crystal Structure Of Human Ste20-Like Kinase Bound 9e-05
1mq4_A 272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-04
2j5e_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 1e-04
3e5a_A 268 Crystal Structure Of Aurora A In Complex With Vx-68 1e-04
1xkk_A 352 Egfr Kinase Domain Complexed With A Quinazoline Inh 1e-04
3h0y_A 268 Aurora A In Complex With A Bisanilinopyrimidine Len 1e-04
3o50_A 267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 1e-04
3ha6_A 268 Crystal Structure Of Aurora A In Complex With Tpx2 1e-04
2w1d_A 275 Structure Determination Of Aurora Kinase In Complex 1e-04
2w1c_A 275 Structure Determination Of Aurora Kinase In Complex 1e-04
2itt_A 327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 1e-04
2j5f_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 1e-04
2rfd_A 324 Crystal Structure Of The Complex Between The Egfr K 1e-04
2gs2_A 330 Crystal Structure Of The Active Egfr Kinase Domain 1e-04
2gs7_A 330 Crystal Structure Of The Inactive Egfr Kinase Domai 1e-04
4i20_A 329 Crystal Structure Of Monomeric (v948r) Primary Onco 1e-04
4g5j_A 330 Crystal Structure Of Egfr Kinase In Complex With Bi 1e-04
2xne_A 272 Structure Of Aurora-A Bound To An Imidazopyrazine I 1e-04
4hjo_A 337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 1e-04
3ug1_A 334 Crystal Structure Of The Mutated Egfr Kinase Domain 1e-04
3ubd_A 304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-04
3ujg_A 361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 1e-04
3zuu_A 362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 1e-04
3zut_A 362 The Structure Of Ost1 (D160a) Kinase Length = 362 1e-04
2wqe_A 262 Structure Of S155r Aurora-A Somatic Mutant Length = 1e-04
4i23_A 329 Crystal Structure Of The Wild-type Egfr Kinase Doma 1e-04
1m14_A 333 Tyrosine Kinase Domain From Epidermal Growth Factor 1e-04
4el9_A 305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 1e-04
3vjo_A 334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 1e-04
2eb3_A 334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 1e-04
2j50_A 280 Structure Of Aurora-2 In Complex With Pha-739358 Le 1e-04
3unz_A 279 Aurora A In Complex With Rpm1679 Length = 279 1e-04
3fdn_A 279 Structure-Based Drug Design Of Novel Aurora Kinase 1e-04
2hak_A 328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 1e-04
3qbn_A 281 Structure Of Human Aurora A In Complex With A Diami 1e-04
2xru_A 280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-04
3nrm_A 283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 1e-04
2c6e_A 283 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-04
2wtv_A 285 Aurora-A Inhibitor Structure Length = 285 1e-04
2xng_A 283 Structure Of Aurora-A Bound To A Selective Imidazop 1e-04
3lau_A 287 Crystal Structure Of Aurora2 Kinase In Complex With 1e-04
2c6d_A 275 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-04
2bfy_A 284 Complex Of Aurora-B With Incenp And Hesperidin. Len 1e-04
1ol5_A 282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-04
2x6d_A 285 Aurora-A Bound To An Inhibitor Length = 285 1e-04
2bfx_B 284 Mechanism Of Aurora-B Activation By Incenp And Inhi 1e-04
1ol6_A 282 Structure Of Unphosphorylated D274n Mutant Of Auror 1e-04
3lzb_A 327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 1e-04
2wtw_A 285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 1e-04
2dwb_A 285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-04
2vrx_A 285 Structure Of Aurora B Kinase In Complex With Zm4474 1e-04
1muo_A 297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 1e-04
2bmc_A 306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 1e-04
2j4z_A 306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-04
1oit_A 299 Imidazopyridines: A Potent And Selective Class Of C 2e-04
4erw_A 306 Cdk2 In Complex With Staurosporine Length = 306 2e-04
1gz8_A 299 Human Cyclin Dependent Kinase 2 Complexed With The 2e-04
4eop_A 300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-04
2w17_A 299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 2e-04
1jst_A 298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 2e-04
1fin_A 298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 2e-04
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-04
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-04
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-04
1fvr_A 327 Tie2 Kinase Domain Length = 327 2e-04
1qmz_A 299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 2e-04
2jgz_A 289 Crystal Structure Of Phospho-Cdk2 In Complex With C 2e-04
3bht_A 300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 2e-04
1ogu_A 302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 2e-04
3pj8_A 299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 2e-04
4eos_A 300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-04
4eoq_A 301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-04
4bcq_A 301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 2e-04
1pf8_A 298 Crystal Structure Of Human Cyclin-dependent Kinase 2e-04
3pxf_A 306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 2e-04
3ezr_A 300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 2e-04
1h1p_A 303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 2e-04
3qhr_A 298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 2e-04
1w98_A 298 The Structural Basis Of Cdk2 Activation By Cyclin E 2e-04
1e9h_A 297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 2e-04
2wqb_A 324 Structure Of The Tie2 Kinase Domain In Complex With 2e-04
2w1i_A 326 Structure Determination Of Aurora Kinase In Complex 2e-04
4eoo_A 299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-04
4i3z_A 296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 2e-04
1vyw_A 309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 2e-04
3fe3_A 328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 2e-04
2qnj_A 328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-04
1gjo_A 316 The Fgfr2 Tyrosine Kinase Domain Length = 316 2e-04
3ri1_A 313 Crystal Structure Of The Catalytic Domain Of Fgfr2 2e-04
3b2t_A 311 Structure Of Phosphotransferase Length = 311 2e-04
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-04
1y6a_A 366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 3e-04
4agc_A 353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 3e-04
3vhk_A 368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-04
3vid_A 356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 3e-04
3vhe_A 359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 3e-04
1fot_A 318 Structure Of The Unliganded Camp-Dependent Protein 3e-04
2oh4_A 316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 3e-04
3c7q_A 316 Structure Of Vegfr2 Kinase Domain In Complex With B 3e-04
1ywn_A 316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 3e-04
2xir_A 316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-04
1vr2_A 316 Human Vascular Endothelial Growth Factor Receptor 2 3e-04
2p2i_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-04
4e6d_A 298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 3e-04
3vnt_A 318 Crystal Structure Of The Kinase Domain Of Human Veg 3e-04
3uc3_A 361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 3e-04
2ozo_A 613 Autoinhibited Intact Human Zap-70 Length = 613 3e-04
2w4o_A 349 Crystal Structure Of Human Camk4 In Complex With 4- 3e-04
4eoi_A 299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 3e-04
1u59_A 287 Crystal Structure Of The Zap-70 Kinase Domain In Co 4e-04
2iw8_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 4e-04
2uv2_A 287 Crystal Structure Of Human Ste20-Like Kinase Bound 4e-04
2iw6_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 4e-04
4apc_A 350 Crystal Structure Of Human Nima-Related Kinase 1 (N 4e-04
2yza_A 276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 4e-04
4eok_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 4e-04
2p2h_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-04
2h6d_A 276 Protein Kinase Domain Of The Human 5'-Amp-Activated 4e-04
4eon_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-04
3ewh_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-04
3u6j_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-04
4eoj_A 302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 4e-04
3cly_A 334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 4e-04
2pzr_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 4e-04
2pvy_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 4e-04
4euu_A 319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 4e-04
4eut_A 396 Structure Of Bx-795 Complexed With Unphosphorylated 4e-04
4eom_A 301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-04
2g15_A 318 Structural Characterization Of Autoinhibited C-Met 5e-04
2j7t_A 302 Crystal Structure Of Human Serine Threonine Kinase- 5e-04
4bc6_A 293 Crystal Structure Of Human Serine Threonine Kinase- 5e-04
2pz5_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-04
2pwl_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-04
1y8g_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-04
1ob3_A 288 Structure Of P. Falciparum Pfpk5 Length = 288 5e-04
1v0o_A 288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 5e-04
3gop_A 361 Crystal Structure Of The Egf Receptor Juxtamembrane 5e-04
2wd1_A 292 Human C-Met Kinase In Complex With Azaindole Inhibi 5e-04
1v0b_A 288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 6e-04
1r0p_A 312 Crystal Structure Of The Tyrosine Kinase Domain Of 6e-04
2itn_A 327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 6e-04
3lq8_A 302 Structure Of The Kinase Domain Of C-Met Bound To Xl 6e-04
3qti_A 314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 6e-04
3dkg_A 317 Sgx Clone 5698a109kfg1h1 Length = 317 6e-04
2pvf_A 334 Crystal Structure Of Tyrosine Phosphorylated Activa 6e-04
2wgj_A 306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 6e-04
3dkc_A 317 Sgx Clone 5698a65kfg1h1 Length = 317 6e-04
3cth_A 314 Crystal Structure Of The Tyrosine Kinase Domain Of 6e-04
2x7f_A 326 Crystal Structure Of The Kinase Domain Of Human Tra 6e-04
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 6e-04
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 6e-04
3srv_A 277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 6e-04
2rfn_A 310 X-ray Structure Of C-met With Inhibitor. Length = 3 6e-04
3srv_B 277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 6e-04
2eb2_A 334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 6e-04
4f4p_A 273 Syk In Complex With Ligand Lasw836 Length = 273 6e-04
3q6w_A 307 Structure Of Dually-phosphorylated Met Receptor Kin 6e-04
3q6u_A 308 Structure Of The Apo Met Receptor Kinase In The Dua 6e-04
3tub_A 293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 6e-04
3vf8_A 299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 6e-04
4dfl_A 274 Crystal Structure Of Spleen Tyrosine Kinase Complex 6e-04
3f66_A 298 Human C-Met Kinase In Complex With Quinoxaline Inhi 6e-04
3emg_A 291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 6e-04
4e4l_A 302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 6e-04
3i5n_A 309 Crystal Structure Of C-Met With Triazolopyridazine 6e-04
4fl3_A 635 Structural And Biophysical Characterization Of The 7e-04
1xba_A 291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 7e-04
1gii_A 298 Human Cyclin Dependent Kinase 2 Complexed With The 7e-04
3eyg_A 290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 7e-04
4fl2_A 636 Structural And Biophysical Characterization Of The 7e-04
1oir_A 299 Imidazopyridines: A Potent And Selective Class Of C 7e-04
1h01_A 298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 7e-04
3g51_A 325 Structural Diversity Of The Active Conformation Of 8e-04
2wqm_A 310 Structure Of Apo Human Nek7 Length = 310 8e-04
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 9e-04
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure

Iteration: 1

Score = 118 bits (296), Expect = 7e-28, Method: Compositional matrix adjust. Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 1/79 (1%) Query: 6 KIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGN 65 ++VG+GAFGVV K W+ + VA+K IE+E+ERKAF VE+RQLSRV+HPNIVKLYGAC N Sbjct: 14 EVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACL-N 72 Query: 66 PVCLVMEYAEGGSLYNELQ 84 PVCLVMEYAEGGSLYN L Sbjct: 73 PVCLVMEYAEGGSLYNVLH 91
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|3MY0|A Chain A, Crystal Structure Of The Acvrl1 (Alk1) Kinase Domain Bound To Ldn- 193189 Length = 305 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3MTF|A Chain A, Crystal Structure Of The Acvr1 Kinase In Complex With A 2- Aminopyridine Inhibitor Length = 301 Back     alignment and structure
>pdb|4DYM|A Chain A, Crystal Structure Of The Acvr1 Kinase Domain In Complex With The Imidazo[1,2-B]pyridazine Inhibitor K00135 Length = 301 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|3MDY|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Bone Morp Protein Receptor Type-1b (Bmpr1b) In Complex With Fkbp12 An 193189 Length = 337 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|3KMU|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Apo) Length = 271 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 7e-37
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 1e-33
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-33
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 3e-33
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-31
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 5e-31
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 6e-31
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 9e-31
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-30
3q4u_A 301 Activin receptor type-1; structural genomics conso 1e-30
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-29
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 2e-29
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 2e-29
3soc_A 322 Activin receptor type-2A; structural genomics cons 2e-27
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 8e-27
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 2e-26
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 6e-26
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 3e-25
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 5e-25
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 5e-25
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 6e-25
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 8e-25
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 9e-25
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-24
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 1e-24
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 2e-24
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-24
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 2e-24
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 2e-24
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-24
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-24
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 3e-24
4aoj_A 329 High affinity nerve growth factor receptor; transf 4e-24
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 4e-24
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 5e-24
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 5e-24
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 6e-24
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 6e-24
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 9e-24
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-23
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 1e-23
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-23
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 1e-23
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 1e-23
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 1e-23
3zzw_A 289 Tyrosine-protein kinase transmembrane receptor RO; 1e-23
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 3e-23
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 4e-23
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 5e-23
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 5e-23
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 7e-23
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 9e-23
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 1e-22
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-22
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-22
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 2e-22
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 2e-22
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 2e-22
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 4e-22
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 4e-22
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 4e-22
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 5e-22
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 5e-22
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 9e-22
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 2e-21
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 4e-21
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 4e-21
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 6e-21
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 7e-21
3pls_A 298 Macrophage-stimulating protein receptor; protein k 1e-20
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-20
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 8e-20
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 2e-19
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 2e-19
2a19_B 284 Interferon-induced, double-stranded RNA-activated 5e-19
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 1e-18
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 1e-18
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-18
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-18
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 3e-18
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 8e-18
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 9e-18
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 2e-17
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 3e-17
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 4e-17
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 5e-17
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 7e-17
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 9e-17
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 9e-17
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 1e-16
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-16
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 2e-16
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-16
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-16
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-16
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 4e-16
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 5e-16
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 5e-16
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 6e-16
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 8e-16
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 8e-16
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 9e-16
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-15
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 1e-15
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 1e-15
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-15
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 3e-15
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 3e-15
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 3e-15
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 4e-15
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 4e-15
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-15
3bhy_A 283 Death-associated protein kinase 3; death associate 4e-15
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 4e-15
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 4e-15
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 5e-15
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 5e-15
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 6e-15
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 8e-15
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 9e-15
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 1e-14
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 1e-14
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-14
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 1e-14
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 2e-14
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 2e-14
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 3e-14
3aln_A 327 Dual specificity mitogen-activated protein kinase; 4e-14
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 5e-14
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 5e-14
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 5e-14
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 6e-14
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 8e-14
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 8e-14
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 1e-13
3fme_A 290 Dual specificity mitogen-activated protein kinase; 1e-13
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-13
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 2e-13
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 2e-13
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 3e-13
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 4e-13
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 4e-13
2dyl_A 318 Dual specificity mitogen-activated protein kinase 4e-13
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 6e-13
3an0_A 340 Dual specificity mitogen-activated protein kinase; 6e-13
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 8e-13
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 9e-13
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-12
3uqc_A 286 Probable conserved transmembrane protein; structur 1e-12
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-12
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-12
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 3e-12
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 4e-12
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 4e-12
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 5e-12
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 6e-12
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 7e-12
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 8e-12
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 1e-11
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 2e-11
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 2e-11
3niz_A 311 Rhodanese family protein; structural genomics, str 2e-11
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 2e-11
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 2e-11
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 3e-11
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-11
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 4e-11
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 4e-11
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 4e-11
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 5e-11
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 5e-11
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 6e-11
3o0g_A 292 Cell division protein kinase 5; kinase activator c 6e-11
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 7e-11
3g51_A 325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 7e-11
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 8e-11
3rp9_A 458 Mitogen-activated protein kinase; structural genom 9e-11
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 9e-11
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-10
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 1e-10
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 2e-10
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 2e-10
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 3e-10
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 3e-10
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 3e-10
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 4e-10
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 9e-10
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 1e-09
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 2e-09
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 3e-09
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 3e-09
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 4e-09
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 5e-09
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 5e-09
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-08
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 3e-08
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 3e-08
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 3e-08
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 3e-08
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 4e-08
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 4e-08
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 4e-08
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 5e-08
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 6e-08
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 6e-08
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 8e-08
3ork_A 311 Serine/threonine protein kinase; structural genomi 1e-07
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-07
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 1e-07
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 2e-07
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 4e-07
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 2e-06
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 2e-06
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 2e-06
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 3e-06
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 5e-06
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 5e-06
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 5e-06
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 8e-06
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 2e-05
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 2e-05
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 3e-05
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 3e-05
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 1e-04
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 3e-04
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
 Score =  125 bits (316), Expect = 7e-37
 Identities = 58/81 (71%), Positives = 69/81 (85%), Gaps = 1/81 (1%)

Query: 6  KIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACTGN 65
          ++VG+GAFGVV K  W+ + VA+K IE+E+ERKAF VE+RQLSRV+HPNIVKLYGAC  N
Sbjct: 14 EVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACL-N 72

Query: 66 PVCLVMEYAEGGSLYNELQRS 86
          PVCLVMEYAEGGSLYN L  +
Sbjct: 73 PVCLVMEYAEGGSLYNVLHGA 93


>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.92
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.91
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.9
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.9
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.89
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.89
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.89
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.89
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.88
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.88
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.88
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.87
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.86
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.86
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.86
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.85
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.84
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.83
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.82
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.8
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.79
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.79
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.78
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.78
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.78
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.77
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.77
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.77
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.77
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.77
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.77
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.77
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.76
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.76
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.76
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.76
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.76
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.76
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.76
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.76
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.76
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.76
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.76
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.76
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.76
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.75
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.75
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.75
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.75
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.75
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.75
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.74
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.74
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.74
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.74
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.74
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.74
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.74
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.74
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.73
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.73
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.73
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.73
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.73
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.73
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.73
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.73
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.73
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.73
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.73
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.73
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.73
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.72
3bhy_A 283 Death-associated protein kinase 3; death associate 99.72
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.72
3uqc_A 286 Probable conserved transmembrane protein; structur 99.72
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.72
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.72
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.72
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.72
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.72
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.72
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.72
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.72
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.72
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.72
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.72
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.72
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.72
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.72
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.71
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.71
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 99.71
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.71
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.71
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.71
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.71
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.71
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.71
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.71
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.71
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.71
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.71
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.71
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.7
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.7
3niz_A 311 Rhodanese family protein; structural genomics, str 99.7
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.7
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.7
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.7
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.7
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.7
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.7
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.7
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.7
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.69
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.69
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.69
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.69
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.69
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.69
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.69
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.69
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.69
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.69
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.69
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.69
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.69
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.69
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.69
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.69
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.69
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.69
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.68
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.68
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.68
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.68
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.68
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.68
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.68
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.68
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.68
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.68
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.67
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.67
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.67
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.67
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.67
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.67
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.67
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.67
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.67
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.67
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.67
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.67
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.67
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.67
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.67
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.67
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.66
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.66
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.66
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.66
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.66
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 99.66
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.66
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.66
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.65
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.65
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.65
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.65
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.65
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.65
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.64
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.64
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.64
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.64
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.64
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.64
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.64
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.64
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.64
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.63
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.63
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.63
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.63
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.62
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.62
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.62
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.62
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.62
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.62
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.62
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.62
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.62
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.62
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.62
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.61
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.61
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.61
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.6
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.6
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.6
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.6
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.6
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.6
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.6
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.6
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.59
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.59
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.59
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.58
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.58
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.58
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.58
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.58
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.58
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.57
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.56
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.56
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.56
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.56
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.56
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.56
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.56
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.55
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.55
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.55
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.55
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.55
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.55
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.54
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.54
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.53
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.52
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.52
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.49
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.49
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.49
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.49
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.49
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.48
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.48
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.48
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.47
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.47
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.46
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.44
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.43
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.37
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.35
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.31
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.0
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.73
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 98.72
3tm0_A 263 Aminoglycoside 3'-phosphotransferase; protein kina 97.65
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.3
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 96.65
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 96.6
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 96.5
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 95.31
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 95.16
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 95.07
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 94.8
4gkh_A 272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 93.47
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 93.45
3sg8_A 304 APH(2'')-ID; antibiotic resistance enzyme, transfe 92.62
2q83_A 346 YTAA protein; 2635576, structural genomics, joint 85.99
3ats_A 357 Putative uncharacterized protein; hypothetical pro 84.08
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=99.92  E-value=1.6e-25  Score=135.46  Aligned_cols=104  Identities=23%  Similarity=0.301  Sum_probs=93.2

Q ss_pred             CCCceeEeecCcceEEEEEEC--CceEEEEEecCHH-----HHHHHHHHHHHHhcCCCCceeeeeeeE-ecCceEEEEee
Q psy9377           2 LGGSKIVGQGAFGVVWKGLWQ--NQYVAVKHIETEA-----ERKAFAVEVRQLSRVSHPNIVKLYGAC-TGNPVCLVMEY   73 (106)
Q Consensus         2 ~~~~~~lg~g~~~~v~~~~~~--~~~~~~k~~~~~~-----~~~~~~~~~~~~~~~~~~~i~~~~~~~-~~~~~~lv~e~   73 (106)
                      |++.+.||+|+||.||++.++  +..+|+|.++...     ....+.+|+.++..++||||+++++.+ +.+.+|+||||
T Consensus        34 y~i~~~lG~G~fg~V~~a~~~~~~~~~AiK~i~k~~~~~~~~~~~~~~E~~il~~l~HpnIv~l~~~~~~~~~~yivmEy  113 (311)
T 4aw0_A           34 FKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSY  113 (311)
T ss_dssp             EEEEEEEEEETTEEEEEEEETTTCCEEEEEEEEHHHHHHTTCHHHHHHHHHHHTTCCCTTBCCEEEEEECSSEEEEEECC
T ss_pred             cEEEEEEecccCeEEEEEEECCCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHHHhCCCCCCCeEEEEEEeCCEEEEEEec
Confidence            677899999999999999987  7899999996432     245688999999999999999999999 45789999999


Q ss_pred             cCCCChHHHHhcCCCCchhhhhhhhhccccCC
Q psy9377          74 AEGGSLYNELQRSSAASLKFCKIYLPFWFSSS  105 (106)
Q Consensus        74 ~~~g~l~~~l~~~~~~~~~~~~~~~~qll~~~  105 (106)
                      ++||+|.+++++.+.+++..++.++.|++.||
T Consensus       114 ~~gG~L~~~i~~~~~l~e~~~~~~~~qi~~al  145 (311)
T 4aw0_A          114 AKNGELLKYIRKIGSFDETCTRFYTAEIVSAL  145 (311)
T ss_dssp             CTTEEHHHHHHHHSSCCHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHcCCCCHHHHHHHHHHHHHHH
Confidence            99999999999888899999999999999886



>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 106
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-28
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-26
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 6e-26
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 8e-25
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 9e-25
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-24
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-24
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 5e-24
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-23
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-23
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-23
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-23
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 4e-23
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 8e-23
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-22
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-22
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-22
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 3e-22
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-22
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 3e-22
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 7e-22
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 8e-22
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 9e-22
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-21
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-21
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 4e-21
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 6e-21
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 8e-21
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-20
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-20
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-20
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-20
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-20
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-19
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 1e-19
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-19
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 6e-19
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 8e-19
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-18
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-18
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 4e-18
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-18
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 8e-18
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 9e-18
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 2e-17
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-17
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-17
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 4e-17
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 8e-17
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-16
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-16
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 4e-16
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-16
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 1e-15
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-15
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 4e-15
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-14
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-14
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-13
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-13
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-13
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 6e-12
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 3e-07
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Carboxyl-terminal src kinase (csk)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  100 bits (251), Expect = 3e-28
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 6   KIVGQGAFGVVWKGLWQNQYVAVKHIETEAERKAFAVEVRQLSRVSHPNIVKLYGACT-- 63
           + +G+G FG V  G ++   VAVK I+ +A  +AF  E   ++++ H N+V+L G     
Sbjct: 13  QTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEE 72

Query: 64  GNPVCLVMEYAEGGSLYNELQRSSAASL 91
              + +V EY   GSL + L+    + L
Sbjct: 73  KGGLYIVTEYMAKGSLVDYLRSRGRSVL 100


>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.9
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.9
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.9
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.89
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.89
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.89
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.89
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.89
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.89
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.88
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.88
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.88
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.88
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.88
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.88
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.87
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.86
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.86
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.86
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.86
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.86
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.85
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.85
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.85
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.85
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.84
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.84
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.84
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.83
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.82
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.82
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.82
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.81
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.81
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.81
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.79
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.79
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.78
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.77
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.77
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.77
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.77
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.77
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.76
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.76
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.76
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.76
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.76
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.75
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.75
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.75
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.74
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.74
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.73
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.7
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.68
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.67
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.66
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.38
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.16
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 91.18
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 82.19
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=1.2e-24  Score=128.31  Aligned_cols=104  Identities=23%  Similarity=0.377  Sum_probs=90.9

Q ss_pred             CCCceeEeecCcceEEEEEEC--CceEEEEEecCH---HHHHHHHHHHHHHhcCCCCceeeeeeeE-ecCceEEEEeecC
Q psy9377           2 LGGSKIVGQGAFGVVWKGLWQ--NQYVAVKHIETE---AERKAFAVEVRQLSRVSHPNIVKLYGAC-TGNPVCLVMEYAE   75 (106)
Q Consensus         2 ~~~~~~lg~g~~~~v~~~~~~--~~~~~~k~~~~~---~~~~~~~~~~~~~~~~~~~~i~~~~~~~-~~~~~~lv~e~~~   75 (106)
                      |++.+.||+|+||.||++.++  +..+|+|.++..   ...+.+.+|+.++..++|||++++++.+ ..+..++||||++
T Consensus         7 y~~~~~lG~G~fg~V~~~~~~~~~~~vAiK~i~~~~~~~~~~~~~~Ei~~l~~l~HpnIv~~~~~~~~~~~~~ivmEy~~   86 (271)
T d1nvra_           7 WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCS   86 (271)
T ss_dssp             EEEEEEEEEETTEEEEEEEETTTCCEEEEEEEECC-------CHHHHHHHHHTCCCTTBCCEEEEEEETTEEEEEEECCT
T ss_pred             eEEEEEEecCcCeEEEEEEECCCCCEEEEEEEehhhcchHHHHHHHHHHHHHhCCCCCEeeEeeeeccCceeEEEEeccC
Confidence            677899999999999999987  789999998633   2245688999999999999999999999 5578999999999


Q ss_pred             CCChHHHHhcCCCCchhhhhhhhhccccCC
Q psy9377          76 GGSLYNELQRSSAASLKFCKIYLPFWFSSS  105 (106)
Q Consensus        76 ~g~l~~~l~~~~~~~~~~~~~~~~qll~~~  105 (106)
                      +|+|.+++..++.++++.++.++.|++.||
T Consensus        87 gg~L~~~l~~~~~l~e~~~~~i~~qi~~al  116 (271)
T d1nvra_          87 GGELFDRIEPDIGMPEPDAQRFFHQLMAGV  116 (271)
T ss_dssp             TEEGGGGSBTTTBCCHHHHHHHHHHHHHHH
T ss_pred             CCcHHHHHhcCCCCCHHHHHHHHHHHHHHH
Confidence            999999998888899999999999999886



>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure