Diaphorina citri psyllid: psy9398


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHIDTGYPGGIRKINFLKMQEDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKINVRGGGESGQYGAVRHGITRAFNQL
ccEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccEEEEEEEccccEEEEcccccccccccHHHHHHHHHHHHHHcccccccEEEEECccccccHHHHHHHHHHHHHHcc
MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHIDTGYPGGIRKINFLKMQEDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKINVRGGGESGQYGAVRHGITRAFNQL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHIDTGYPGGIRKINFLKMQEDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKINVRGGGESGQYGAVRHGITRAFNQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S9 confidentA4G1T3
30S ribosomal protein S9 confidentA6SUN8
30S ribosomal protein S9 confidentA1K970

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain L
Confidence level:very confident
Coverage over the Query: 1-98
View the alignment between query and template
View the model in PyMOL
Template: 3BBN, chain I
Confidence level:very confident
Coverage over the Query: 71-154
View the alignment between query and template
View the model in PyMOL