Psyllid ID: psy9398

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHIDTGYPGGIRKINFLKMQEDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKINVRGGGESGQYGAVRHGITRAFNQL
ccEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEEccccEEEEcccccccccccHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHcc
cEEEEEcccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHccccccccccccEEEEEEcccccEEEEccccHHHHcccHHHHHHHccccEEEEccccEEEEEEEcccccccHHHHHHHHHHHHHHcc
MWFLIDAKNKILGRVASKIAVYLRgkhkteytphidtgypggirKINFLKMQEDFPGRVLQKAVKVVNykygtgrrkSAIARVFIKIgsgkmtinripadkyfsrktglmvisqplkltkhtktfdikinvrgggesgqygaVRHGITRAFNQL
mwflidaknkilgrvaSKIAVYlrgkhkteytphidtgypGGIRKINFLKMQEDFPGRVLQKAVKVVnykygtgrrksaiARVFIKigsgkmtinripaDKYFSRKTGLMVisqplkltkhtktfdikinvrgggesgqygavrhGITRAFNQL
MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHIDTGYPGGIRKINFLKMQEDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKINVRGGGESGQYGAVRHGITRAFNQL
*WFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHIDTGYPGGIRKINFLKMQEDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDI***************************
MWFL***KNKILGRVASKIAVYLRGKHKTEYTPHIDTGY*****************************YKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKINVRGGGESGQYGAVRHGITRAFNQL
MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHIDTGYPGGIRKINFLKMQEDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKINVRGGGESGQYGAVRHGITRAFNQL
MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHIDTGYPGGIRKINFLKMQEDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKINVRGGGESGQYGAVRHGITRAFNQL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHIDTGYPGGIRKINFLKMQEDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKINVRGGGESGQYGAVRHGITRAFNQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
A6SUN8130 30S ribosomal protein S9 yes N/A 0.545 0.646 0.726 2e-30
A4G1T3130 30S ribosomal protein S9 yes N/A 0.545 0.646 0.726 2e-30
Q0AHZ9130 30S ribosomal protein S9 yes N/A 0.558 0.661 0.662 2e-28
A3NDG7130 30S ribosomal protein S9 yes N/A 0.545 0.646 0.666 4e-28
Q3JNR2130 30S ribosomal protein S9 yes N/A 0.545 0.646 0.666 4e-28
A3NZ79130 30S ribosomal protein S9 yes N/A 0.545 0.646 0.666 4e-28
A1V052130 30S ribosomal protein S9 yes N/A 0.545 0.646 0.666 4e-28
Q62HB9130 30S ribosomal protein S9 yes N/A 0.545 0.646 0.666 4e-28
A2S582130 30S ribosomal protein S9 yes N/A 0.545 0.646 0.666 4e-28
A3MP60130 30S ribosomal protein S9 yes N/A 0.545 0.646 0.666 4e-28
>sp|A6SUN8|RS9_JANMA 30S ribosomal protein S9 OS=Janthinobacterium sp. (strain Marseille) GN=rpsI PE=3 SV=1 Back     alignment and function desciption
 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/84 (72%), Positives = 72/84 (85%)

Query: 68  NYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDI 127
           NY YGTGRRKSA+ARVFIK GSG++ +N  PA++YFSR+TGLMVI QPL+LT + +TFDI
Sbjct: 4   NYNYGTGRRKSAVARVFIKSGSGQIVVNGKPANEYFSRETGLMVIRQPLELTNNVETFDI 63

Query: 128 KINVRGGGESGQYGAVRHGITRAF 151
            +NV GGGESGQ GAVRHGITRA 
Sbjct: 64  MVNVNGGGESGQAGAVRHGITRAL 87

Janthinobacterium sp. (strain Marseille) (taxid: 375286)
>sp|A4G1T3|RS9_HERAR 30S ribosomal protein S9 OS=Herminiimonas arsenicoxydans GN=rpsI PE=3 SV=1 Back     alignment and function description
>sp|Q0AHZ9|RS9_NITEC 30S ribosomal protein S9 OS=Nitrosomonas eutropha (strain C91) GN=rpsI PE=3 SV=1 Back     alignment and function description
>sp|A3NDG7|RS9_BURP6 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 668) GN=rpsI PE=3 SV=1 Back     alignment and function description
>sp|Q3JNR2|RS9_BURP1 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsI PE=3 SV=1 Back     alignment and function description
>sp|A3NZ79|RS9_BURP0 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsI PE=3 SV=1 Back     alignment and function description
>sp|A1V052|RS9_BURMS 30S ribosomal protein S9 OS=Burkholderia mallei (strain SAVP1) GN=rpsI PE=3 SV=1 Back     alignment and function description
>sp|Q62HB9|RS9_BURMA 30S ribosomal protein S9 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsI PE=3 SV=1 Back     alignment and function description
>sp|A2S582|RS9_BURM9 30S ribosomal protein S9 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsI PE=3 SV=1 Back     alignment and function description
>sp|A3MP60|RS9_BURM7 30S ribosomal protein S9 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsI PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
340789148130 30S ribosomal protein S9 [Collimonas fun 0.545 0.646 0.75 6e-30
237747559130 small subunit ribosomal protein S9 [Oxal 0.545 0.646 0.726 9e-29
152980472130 30S ribosomal protein S9 [Janthinobacter 0.545 0.646 0.726 1e-28
134093524130 30S ribosomal protein S9 [Herminiimonas 0.545 0.646 0.726 1e-28
237747471130 30S ribosomal protein S9 [Oxalobacter fo 0.545 0.646 0.726 2e-28
399018361130 ribosomal protein S9 [Herbaspirillum sp. 0.545 0.646 0.726 4e-28
395760218130 30S ribosomal protein S9 [Janthinobacter 0.545 0.646 0.714 7e-28
329909866130 SSU ribosomal protein S9p (S16e) [Oxalob 0.538 0.638 0.734 7e-28
445494864130 30S ribosomal protein S9 [Janthinobacter 0.545 0.646 0.714 7e-28
300313143130 30S ribosomal protein S9 [Herbaspirillum 0.545 0.646 0.726 1e-27
>gi|340789148|ref|YP_004754613.1| 30S ribosomal protein S9 [Collimonas fungivorans Ter331] gi|340554415|gb|AEK63790.1| SSU ribosomal protein S9p (S16e) [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (86%)

Query: 68  NYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDI 127
           NY YGTGRRKSA+ARVFIK GSG++ +N  PA++YFSR+TGLMVI QPL+LT H +TFDI
Sbjct: 4   NYNYGTGRRKSAVARVFIKSGSGQIVVNGKPANEYFSRETGLMVIRQPLELTNHVETFDI 63

Query: 128 KINVRGGGESGQYGAVRHGITRAF 151
           K+NV GGGESGQ GAVRHGITRA 
Sbjct: 64  KVNVSGGGESGQAGAVRHGITRAL 87

Source: Collimonas fungivorans Ter331

Species: Collimonas fungivorans

Genus: Collimonas

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|237747559|ref|ZP_04578039.1| small subunit ribosomal protein S9 [Oxalobacter formigenes OXCC13] gi|229378921|gb|EEO29012.1| small subunit ribosomal protein S9 [Oxalobacter formigenes OXCC13] Back     alignment and taxonomy information
>gi|152980472|ref|YP_001351985.1| 30S ribosomal protein S9 [Janthinobacterium sp. Marseille] gi|166229565|sp|A6SUN8.1|RS9_JANMA RecName: Full=30S ribosomal protein S9 gi|151280549|gb|ABR88959.1| small subunit ribosomal protein S9 [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|134093524|ref|YP_001098599.1| 30S ribosomal protein S9 [Herminiimonas arsenicoxydans] gi|166229564|sp|A4G1T3.1|RS9_HERAR RecName: Full=30S ribosomal protein S9 gi|133737427|emb|CAL60470.1| 30S ribosomal protein S9 [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|237747471|ref|ZP_04577951.1| 30S ribosomal protein S9 [Oxalobacter formigenes HOxBLS] gi|229378822|gb|EEO28913.1| 30S ribosomal protein S9 [Oxalobacter formigenes HOxBLS] Back     alignment and taxonomy information
>gi|399018361|ref|ZP_10720541.1| ribosomal protein S9 [Herbaspirillum sp. CF444] gi|398101606|gb|EJL91818.1| ribosomal protein S9 [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|395760218|ref|ZP_10440887.1| 30S ribosomal protein S9 [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|329909866|ref|ZP_08275137.1| SSU ribosomal protein S9p (S16e) [Oxalobacteraceae bacterium IMCC9480] gi|327546384|gb|EGF31396.1| SSU ribosomal protein S9p (S16e) [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
>gi|445494864|ref|ZP_21461908.1| 30S ribosomal protein S9 [Janthinobacterium sp. HH01] gi|444791025|gb|ELX12572.1| 30S ribosomal protein S9 [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|300313143|ref|YP_003777235.1| 30S ribosomal protein S9 [Herbaspirillum seropedicae SmR1] gi|409407618|ref|ZP_11256069.1| 30S ribosomal protein S9 [Herbaspirillum sp. GW103] gi|415950555|ref|ZP_11556987.1| Small subunit ribosomal protein S9 [Herbaspirillum frisingense GSF30] gi|300075928|gb|ADJ65327.1| 30S ribosomal subunit S9 protein [Herbaspirillum seropedicae SmR1] gi|386433369|gb|EIJ46195.1| 30S ribosomal protein S9 [Herbaspirillum sp. GW103] gi|407757614|gb|EKF67565.1| Small subunit ribosomal protein S9 [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
TIGR_CMR|GSU_2875130 GSU_2875 "ribosomal protein S9 0.538 0.638 0.547 3.4e-22
TIGR_CMR|SO_3939130 SO_3939 "ribosomal protein S9" 0.545 0.646 0.571 9e-22
UNIPROTKB|P0A7X3130 rpsI "30S ribosomal subunit pr 0.538 0.638 0.578 1e-20
TIGR_CMR|CPS_4442130 CPS_4442 "ribosomal protein S9 0.538 0.638 0.578 1e-20
UNIPROTKB|Q9KUF0130 rpsI "30S ribosomal protein S9 0.538 0.638 0.578 1.3e-20
TIGR_CMR|VC_0571130 VC_0571 "ribosomal protein S9" 0.538 0.638 0.578 1.3e-20
TIGR_CMR|CBU_1748139 CBU_1748 "ribosomal protein S9 0.590 0.654 0.515 1.5e-19
TIGR_CMR|CHY_2273130 CHY_2273 "ribosomal protein S9 0.564 0.669 0.556 1.9e-19
TIGR_CMR|SPO_1692160 SPO_1692 "ribosomal protein S9 0.519 0.5 0.462 2e-15
TAIR|locus:2101373430 AT3G49080 [Arabidopsis thalian 0.649 0.232 0.456 1.7e-14
TIGR_CMR|GSU_2875 GSU_2875 "ribosomal protein S9" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
 Score = 258 (95.9 bits), Expect = 3.4e-22, P = 3.4e-22
 Identities = 46/84 (54%), Positives = 66/84 (78%)

Query:    67 VNYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFD 126
             ++Y YGTG+RKS++ARV++K G+G + IN  P D+YF R+T  M++ QPL+L +    FD
Sbjct:     4 ISY-YGTGKRKSSVARVWLKPGTGAIVINNKPIDEYFGRETSKMIVKQPLELVEKVGAFD 62

Query:   127 IKINVRGGGESGQYGAVRHGITRA 150
             I +NVRGGG+SGQ GA++HGIT+A
Sbjct:    63 IYVNVRGGGDSGQAGAIKHGITKA 86
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0006412 "translation" evidence=ISS
GO:0042254 "ribosome biogenesis" evidence=ISS
TIGR_CMR|SO_3939 SO_3939 "ribosomal protein S9" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|P0A7X3 rpsI "30S ribosomal subunit protein S9" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4442 CPS_4442 "ribosomal protein S9" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUF0 rpsI "30S ribosomal protein S9" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0571 VC_0571 "ribosomal protein S9" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1748 CBU_1748 "ribosomal protein S9" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2273 CHY_2273 "ribosomal protein S9" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1692 SPO_1692 "ribosomal protein S9" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TAIR|locus:2101373 AT3G49080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A1K970RS9_AZOSBNo assigned EC number0.63950.55840.6615yesN/A
Q62HB9RS9_BURMANo assigned EC number0.66660.54540.6461yesN/A
B2AH58RS9_CUPTRNo assigned EC number0.65470.54540.6461yesN/A
A2S582RS9_BURM9No assigned EC number0.66660.54540.6461yesN/A
Q7NRT4RS9_CHRVONo assigned EC number0.63850.53890.6384yesN/A
B8CIP3RS9_SHEPWNo assigned EC number0.55950.54540.6461yesN/A
Q3JNR2RS9_BURP1No assigned EC number0.66660.54540.6461yesN/A
B4EET5RS9_BURCJNo assigned EC number0.66660.54540.6461yesN/A
A9I240RS9_BORPDNo assigned EC number0.64280.54540.6461yesN/A
A0K4K6RS9_BURCHNo assigned EC number0.66660.54540.6461yesN/A
Q0KED8RS9_CUPNHNo assigned EC number0.65470.54540.6461yesN/A
A3NZ79RS9_BURP0No assigned EC number0.66660.54540.6461yesN/A
Q63QW4RS9_BURPSNo assigned EC number0.66660.54540.6461yesN/A
B2UFK2RS9_RALPJNo assigned EC number0.64280.54540.6461yesN/A
Q13UB3RS9_BURXLNo assigned EC number0.66660.54540.6461yesN/A
A1V052RS9_BURMSNo assigned EC number0.66660.54540.6461yesN/A
Q2SZ68RS9_BURTANo assigned EC number0.66660.54540.6461yesN/A
B1Y3K6RS9_LEPCPNo assigned EC number0.59520.54540.6461yesN/A
Q5P7T8RS9_AROAENo assigned EC number0.64700.55190.6538yesN/A
P66642RS9_NEIMBNo assigned EC number0.59030.53890.6384yesN/A
Q0BI90RS9_BURCMNo assigned EC number0.66660.54540.6461yesN/A
Q2YBK3RS9_NITMUNo assigned EC number0.67460.53890.6384yesN/A
Q2KV03RS9_BORA1No assigned EC number0.64280.54540.6461yesN/A
B2JGV1RS9_BURP8No assigned EC number0.66660.54540.6461yesN/A
B1JVU5RS9_BURCCNo assigned EC number0.66660.54540.6461yesN/A
Q7W3Z2RS9_BORPANo assigned EC number0.64280.54540.6461yesN/A
Q0AHZ9RS9_NITECNo assigned EC number0.66270.55840.6615yesN/A
Q39JJ9RS9_BURS3No assigned EC number0.66660.54540.6461yesN/A
A4G1T3RS9_HERARNo assigned EC number0.72610.54540.6461yesN/A
Q1LRC9RS9_RALMENo assigned EC number0.65470.54540.6461yesN/A
A1TUF5RS9_ACIACNo assigned EC number0.60710.54540.6461yesN/A
Q1BZ44RS9_BURCANo assigned EC number0.66660.54540.6461yesN/A
A9AH80RS9_BURM1No assigned EC number0.65470.54540.6461yesN/A
B1YTD2RS9_BURA4No assigned EC number0.66660.54540.6461yesN/A
Q82UK1RS9_NITEUNo assigned EC number0.66270.55840.6615yesN/A
Q3SF20RS9_THIDANo assigned EC number0.66660.56490.6692yesN/A
Q8Y245RS9_RALSONo assigned EC number0.65470.54540.6461yesN/A
A3MP60RS9_BURM7No assigned EC number0.66660.54540.6461yesN/A
Q7WFC4RS9_BORBRNo assigned EC number0.64280.54540.6461yesN/A
A4JBK5RS9_BURVGNo assigned EC number0.66660.54540.6461yesN/A
A3NDG7RS9_BURP6No assigned EC number0.66660.54540.6461yesN/A
A6SUN8RS9_JANMANo assigned EC number0.72610.54540.6461yesN/A
Q7VUV9RS9_BORPENo assigned EC number0.64280.54540.6461yesN/A
B9MD53RS9_ACIETNo assigned EC number0.61900.54540.6461yesN/A
A2SKM0RS9_METPPNo assigned EC number0.63090.54540.6461yesN/A
Q475T2RS9_CUPPJNo assigned EC number0.65470.54540.6461yesN/A
B2SYK9RS9_BURPPNo assigned EC number0.66660.54540.6461yesN/A
A1WL75RS9_VEREINo assigned EC number0.63090.54540.6461yesN/A
A1W3P8RS9_ACISJNo assigned EC number0.61900.54540.6461yesN/A
A1KWD5RS9_NEIMFNo assigned EC number0.59030.53890.6384yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
PRK00132130 PRK00132, rpsI, 30S ribosomal protein S9; Reviewed 3e-40
COG0103130 COG0103, RpsI, Ribosomal protein S9 [Translation, 8e-33
pfam00380121 pfam00380, Ribosomal_S9, Ribosomal protein S9/S16 5e-31
PRK09216144 PRK09216, rplM, 50S ribosomal protein L13; Reviewe 5e-28
CHL00079130 CHL00079, rps9, ribosomal protein S9 2e-22
pfam00572128 pfam00572, Ribosomal_L13, Ribosomal protein L13 4e-20
TIGR01066140 TIGR01066, rplM_bact, ribosomal protein L13, bacte 3e-19
cd00392114 cd00392, Ribosomal_L13, Ribosomal protein L13 2e-18
COG0102148 COG0102, RplM, Ribosomal protein L13 [Translation, 4e-17
CHL00159143 CHL00159, rpl13, ribosomal protein L13; Validated 2e-15
PRK00474134 PRK00474, rps9p, 30S ribosomal protein S9P; Review 9e-14
TIGR03627130 TIGR03627, arch_S9P, archaeal ribosomal protein S9 9e-13
PLN00205191 PLN00205, PLN00205, ribisomal protein L13 family p 5e-08
PLN00210141 PLN00210, PLN00210, 40S ribosomal protein S16; Pro 2e-06
PTZ00086147 PTZ00086, PTZ00086, 40S ribosomal protein S16; Pro 5e-05
>gnl|CDD|178888 PRK00132, rpsI, 30S ribosomal protein S9; Reviewed Back     alignment and domain information 
 Score =  131 bits (332), Expect = 3e-40
 Identities = 46/87 (52%), Positives = 62/87 (71%)

Query: 68  NYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDI 127
              YGTGRRK+A+ARV +K GSGK+T+N    ++YF R+T  MV+ QPL+LT+    FD+
Sbjct: 4   VQYYGTGRRKTAVARVRLKPGSGKITVNGRDLEEYFPRETLRMVVRQPLELTETEGKFDV 63

Query: 128 KINVRGGGESGQYGAVRHGITRAFNQL 154
            + V+GGG SGQ GA+RHGI RA  + 
Sbjct: 64  YVTVKGGGISGQAGAIRHGIARALLEY 90

Length = 130
>gnl|CDD|223181 COG0103, RpsI, Ribosomal protein S9 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|201193 pfam00380, Ribosomal_S9, Ribosomal protein S9/S16 Back     alignment and domain information
>gnl|CDD|181703 PRK09216, rplM, 50S ribosomal protein L13; Reviewed Back     alignment and domain information
>gnl|CDD|214357 CHL00079, rps9, ribosomal protein S9 Back     alignment and domain information
>gnl|CDD|201314 pfam00572, Ribosomal_L13, Ribosomal protein L13 Back     alignment and domain information
>gnl|CDD|162186 TIGR01066, rplM_bact, ribosomal protein L13, bacterial type Back     alignment and domain information
>gnl|CDD|238230 cd00392, Ribosomal_L13, Ribosomal protein L13 Back     alignment and domain information
>gnl|CDD|223180 COG0102, RplM, Ribosomal protein L13 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177072 CHL00159, rpl13, ribosomal protein L13; Validated Back     alignment and domain information
>gnl|CDD|179041 PRK00474, rps9p, 30S ribosomal protein S9P; Reviewed Back     alignment and domain information
>gnl|CDD|132666 TIGR03627, arch_S9P, archaeal ribosomal protein S9P Back     alignment and domain information
>gnl|CDD|177795 PLN00205, PLN00205, ribisomal protein L13 family protein; Provisional Back     alignment and domain information
>gnl|CDD|177799 PLN00210, PLN00210, 40S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|185437 PTZ00086, PTZ00086, 40S ribosomal protein S16; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
PRK09216144 rplM 50S ribosomal protein L13; Reviewed 99.98
TIGR01066140 rplM_bact ribosomal protein L13, bacterial type. T 99.97
PLN00205191 ribisomal protein L13 family protein; Provisional 99.97
CHL00159143 rpl13 ribosomal protein L13; Validated 99.97
cd00392114 Ribosomal_L13 Ribosomal protein L13. Protein L13, 99.97
PF00572128 Ribosomal_L13: Ribosomal protein L13; InterPro: IP 99.97
COG0103130 RpsI Ribosomal protein S9 [Translation, ribosomal 99.97
COG0102148 RplM Ribosomal protein L13 [Translation, ribosomal 99.96
PRK00132130 rpsI 30S ribosomal protein S9; Reviewed 99.96
CHL00079130 rps9 ribosomal protein S9 99.96
PF00380121 Ribosomal_S9: Ribosomal protein S9/S16; InterPro: 99.96
KOG3203|consensus165 99.95
PRK00474134 rps9p 30S ribosomal protein S9P; Reviewed 99.95
PTZ00086147 40S ribosomal protein S16; Provisional 99.95
TIGR03627130 arch_S9P archaeal ribosomal protein S9P. This mode 99.95
PLN00210141 40S ribosomal protein S16; Provisional 99.95
PTZ00068202 60S ribosomal protein L13a; Provisional 99.91
KOG1697|consensus275 99.91
PRK06394146 rpl13p 50S ribosomal protein L13P; Reviewed 99.89
TIGR01077142 L13_A_E ribosomal protein L13, archaeal/eukaryotic 99.87
KOG1753|consensus145 99.71
KOG3204|consensus197 99.47
KOG0058|consensus716 89.2
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 86.27
PTZ002651466 multidrug resistance protein (mdr1); Provisional 83.83
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 81.38
>PRK09216 rplM 50S ribosomal protein L13; Reviewed Back     alignment and domain information 
Probab=99.98  E-value=4.2e-33  Score=209.61  Aligned_cols=96  Identities=40%  Similarity=0.726  Sum_probs=86.8

Q ss_pred             CeEEEeCCCCchhhHHHHHHHHHhCCCceEEeeecc----------------------------ccCCCCeeeecccccc
Q psy9398           1 MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHID----------------------------TGYPGGIRKINFLKMQ   52 (154)
Q Consensus         1 ~w~viDa~~~~lGRlAs~vA~~L~Gk~k~~~~~~~d----------------------------~gy~gg~k~~~~~~~~   52 (154)
                      +||||||+||+||||||+||++|+|||||+|+|+.|                            +|||||++++++++++
T Consensus        14 ~W~viDA~~~~lGRlAs~IAk~L~GKhKp~y~p~~d~Gd~VvViNa~ki~~tG~k~~~k~y~~htg~pGglk~~~~~~~~   93 (144)
T PRK09216         14 KWYVIDAEGKVLGRLASEVASILRGKHKPTFTPHVDTGDFVIVINAEKVKLTGKKLTDKIYYRHSGYPGGLKEITFGELL   93 (144)
T ss_pred             CEEEEeCCCCchHHHHHHHHHHHhccCCCCcCCCCCCCCEEEEEeCceeEEcCchHhheeeEEecccCCCCEEecHHHHh
Confidence            599999999999999999999999999999999997                            4799999999999999


Q ss_pred             ccCchhHHHHhhhhhhcccCccccccccceeeeecCcceEEEcccc
Q psy9398          53 EDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGKMTINRIP   98 (154)
Q Consensus        53 ~r~P~~Il~raV~gmlp~~~~grrK~a~aRv~i~~G~g~i~vN~~~   98 (154)
                      +++|++|+++||+||||++  -+++.++.|+++|+|+.......+|
T Consensus        94 ~r~P~~il~~aVrgMLPkn--~lgr~~~~rLkvy~G~~hp~~~q~p  137 (144)
T PRK09216         94 AKKPERVIEKAVKGMLPKN--PLGRAMFKKLKVYAGAEHPHAAQQP  137 (144)
T ss_pred             hhCHHHHHHHHHHhcCCCC--ccHHHHHhCcEEeCCCCCCccccCC
Confidence            9999999999999999975  4557789999999998755544444

>TIGR01066 rplM_bact ribosomal protein L13, bacterial type Back     alignment and domain information
>PLN00205 ribisomal protein L13 family protein; Provisional Back     alignment and domain information
>CHL00159 rpl13 ribosomal protein L13; Validated Back     alignment and domain information
>cd00392 Ribosomal_L13 Ribosomal protein L13 Back     alignment and domain information
>PF00572 Ribosomal_L13: Ribosomal protein L13; InterPro: IPR005822 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0103 RpsI Ribosomal protein S9 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0102 RplM Ribosomal protein L13 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00132 rpsI 30S ribosomal protein S9; Reviewed Back     alignment and domain information
>CHL00079 rps9 ribosomal protein S9 Back     alignment and domain information
>PF00380 Ribosomal_S9: Ribosomal protein S9/S16; InterPro: IPR000754 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3203|consensus Back     alignment and domain information
>PRK00474 rps9p 30S ribosomal protein S9P; Reviewed Back     alignment and domain information
>PTZ00086 40S ribosomal protein S16; Provisional Back     alignment and domain information
>TIGR03627 arch_S9P archaeal ribosomal protein S9P Back     alignment and domain information
>PLN00210 40S ribosomal protein S16; Provisional Back     alignment and domain information
>PTZ00068 60S ribosomal protein L13a; Provisional Back     alignment and domain information
>KOG1697|consensus Back     alignment and domain information
>PRK06394 rpl13p 50S ribosomal protein L13P; Reviewed Back     alignment and domain information
>TIGR01077 L13_A_E ribosomal protein L13, archaeal/eukaryotic Back     alignment and domain information
>KOG1753|consensus Back     alignment and domain information
>KOG3204|consensus Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
1vs5_I130 Crystal Structure Of The Bacterial Ribosome From Es 1e-21
1p6g_I129 Real Space Refined Coordinates Of The 30s Subunit F 1e-21
3fih_I127 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 1e-21
2gy9_I126 Structure Of The 30s Subunit Of A Pre-Translocation 2e-21
1fjg_I128 Structure Of The Thermus Thermophilus 30s Ribosomal 4e-14
1pns_I127 Crystal Structure Of A Streptomycin Dependent Ribos 4e-14
2hgi_L128 Crystal Structure Of The 70s Thermus Thermophilus R 5e-14
1vsa_H163 Crystal Structure Of A 70s Ribosome-Trna Complex Re 3e-12
3tve_M138 Crystal Structure Analysis Of Ribosomal Decoding. T 3e-12
2j01_N140 Structure Of The Thermus Thermophilus 70s Ribosome 3e-12
1vsp_H140 Interactions And Dynamics Of The Shine-Dalgarno Hel 3e-12
3fin_N139 T. Thermophilus 70s Ribosome In Complex With Mrna, 3e-12
3mrz_J139 Recognition Of The Amber Stop Codon By Release Fact 4e-12
3pyo_J137 Crystal Structure Of A Complex Containing Domain 3 4e-12
2j28_J140 Model Of E. Coli Srp Bound To 70s Rncs Length = 140 2e-10
1p85_H142 Real Space Refined Coordinates Of The 50s Subunit F 2e-10
3bbo_L250 Homology Model For The Spinach Chloroplast 50s Subu 4e-09
3bbn_I197 Homology Model For The Spinach Chloroplast 30s Subu 6e-09
3j20_K135 Promiscuous Behavior Of Proteins In Archaeal Riboso 2e-06
3iz6_I149 Localization Of The Small Subunit Ribosomal Protein 7e-05
1nkw_H174 Crystal Structure Of The Large Ribosomal Subunit Fr 5e-04
1pnu_H143 Crystal Structure Of A Streptomycin Dependent Ribos 5e-04
>pdb|1VS5|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 130 Back     alignment and structure 
Iteration: 1

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (72%)
Query: 68  NYKYGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDI 127
           N  YGTGRRKS+ ARVFIK G+GK+ IN+   ++YF R+T  MV+ QPL+L    +  D+
Sbjct: 4   NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDL 63
Query: 128 KINVRGGGESGQYGAVRHGITRAF 151
            I V+GGG SGQ GA+RHGITRA 
Sbjct: 64  YITVKGGGISGQAGAIRHGITRAL 87
>pdb|1P6G|I Chain I, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 129 Back     alignment and structure
>pdb|3FIH|I Chain I, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 127 Back     alignment and structure
>pdb|2GY9|I Chain I, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 126 Back     alignment and structure
>pdb|1FJG|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 128 Back     alignment and structure
>pdb|1PNS|I Chain I, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 127 Back     alignment and structure
>pdb|2HGI|L Chain L, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgj. Length = 128 Back     alignment and structure
>pdb|1VSA|H Chain H, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome Subunit Is In The File 2ow8 Length = 163 Back     alignment and structure
>pdb|3TVE|M Chain M, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 50s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Cognate Trna-Leu Complex Length = 138 Back     alignment and structure
>pdb|2J01|N Chain N, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 140 Back     alignment and structure
>pdb|1VSP|H Chain H, Interactions And Dynamics Of The Shine-Dalgarno Helix In The 70s Ribosome. This File, 1vsp, Contains The 50s Ribosome Subunit. 30s Ribosome Subunit Is In The File 2qnh Length = 140 Back     alignment and structure
>pdb|3FIN|N Chain N, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 139 Back     alignment and structure
>pdb|3MRZ|J Chain J, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 139 Back     alignment and structure
>pdb|3PYO|J Chain J, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 137 Back     alignment and structure
>pdb|2J28|J Chain J, Model Of E. Coli Srp Bound To 70s Rncs Length = 140 Back     alignment and structure
>pdb|1P85|H Chain H, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 142 Back     alignment and structure
>pdb|3BBO|L Chain L, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 250 Back     alignment and structure
>pdb|3BBN|I Chain I, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 197 Back     alignment and structure
>pdb|3J20|K Chain K, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (30s Ribosomal Subunit) Length = 135 Back     alignment and structure
>pdb|3IZ6|I Chain I, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 149 Back     alignment and structure
>pdb|1NKW|H Chain H, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 174 Back     alignment and structure
>pdb|1PNU|H Chain H, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 143 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
3r8n_I127 30S ribosomal protein S9; protein biosynthesis, RN 2e-39
2vqe_I128 30S ribosomal protein S9, 30S ribosomal protein S6 2e-38
3bbn_I197 Ribosomal protein S9; small ribosomal subunit, spi 2e-37
3iz6_I149 40S ribosomal protein S16 (S9P); eukaryotic riboso 8e-32
2zkq_i146 40S ribosomal protein S16E; protein-RNA complex, 4 2e-31
3u5c_Q143 RP61R, 40S ribosomal protein S16-A; translation, r 7e-31
2xzm_I145 RPS16E; ribosome, translation; 3.93A {Tetrahymena 1e-30
3v2d_N140 50S ribosomal protein L13; ribosome associated inh 6e-27
3r8s_J142 50S ribosomal protein L13; protein biosynthesis, R 6e-27
2zjr_G174 50S ribosomal protein L13; ribosome, large ribosom 1e-26
3f1f_N163 50S ribosomal protein L13; RF2, ribosome, terminat 2e-26
3bbo_L250 Ribosomal protein L13; large ribosomal subunit, sp 6e-26
2ftc_H148 L13MT, MRP-L13, 39S ribosomal protein L13, mitocho 1e-25
3izc_K199 60S ribosomal protein RPL16 (L13P); eukaryotic rib 4e-11
1j3a_A142 50S ribosomal protein L13P; rRNA binding, ribosoma 6e-11
3iz5_K206 60S ribosomal protein L13A (L13P); eukaryotic ribo 1e-10
4a17_I198 RPL13A, 60S ribosomal protein L13A; eukaryotic rib 1e-10
3jyw_M178 60S ribosomal protein L16(A); eukaryotic ribosome, 9e-10
1vq8_J145 50S ribosomal protein L13P; ribosome 50S, protein- 5e-09
2zkr_j203 60S ribosomal protein L13A; protein-RNA complex, 6 1e-08
>2vqe_I 30S ribosomal protein S9, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: d.14.1.1 PDB: 1gix_L* 1hnw_I* 1hnx_I* 1hnz_I* 1hr0_I 1i94_I* 1i95_I* 1i96_I* 1i97_I* 1ibk_I* 1ibl_I* 1ibm_I 1j5e_I 1jgo_L* 1jgp_L* 1jgq_L* 1ml5_L* 1n32_I* 1n33_I* 1n34_I ... Length = 128 Back     alignment and structure
>3bbn_I Ribosomal protein S9; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 197 Back     alignment and structure
>3iz6_I 40S ribosomal protein S16 (S9P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 149 Back     alignment and structure
>2zkq_i 40S ribosomal protein S16E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 146 Back     alignment and structure
>3u5c_Q RP61R, 40S ribosomal protein S16-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_I 3o30_J 3o2z_J 3u5g_Q 1s1h_I 3jyv_I* Length = 143 Back     alignment and structure
>2xzm_I RPS16E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_I Length = 145 Back     alignment and structure
>3v2d_N 50S ribosomal protein L13; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_M 2hgj_M 2hgu_M 2j03_N 2jl6_N 2jl8_N 2v47_N 2v49_N 2wdi_N 2wdj_N 2wdl_N 2wdn_N 2wh2_N 2wh4_N 2wrj_N 2wrl_N 2wro_N 2wrr_N 2x9s_N 2x9u_N ... Length = 140 Back     alignment and structure
>3r8s_J 50S ribosomal protein L13; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 1p85_H 1p86_H 1vs8_J 1vs6_J 2aw4_J 2awb_J 2gya_H 2gyc_H 1vt2_J 2i2v_J 2i2t_J* 2qao_J* 2qba_J* 2qbc_J* 2qbe_J 2qbg_J 2qbi_J* 2qbk_J* 2qov_J 2qox_J ... Length = 142 Back     alignment and structure
>2zjr_G 50S ribosomal protein L13; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: c.21.1.1 PDB: 1nwx_H* 1nwy_H* 1sm1_H* 1xbp_H* 2zjp_G* 2zjq_G 1nkw_H 3cf5_G* 3dll_G* 3pio_G* 3pip_G* 1pnu_H 1pny_H 1vor_K 1vou_K 1vow_K 1voy_K 1vp0_K Length = 174 Back     alignment and structure
>3f1f_N 50S ribosomal protein L13; RF2, ribosome, termination, tRNA; 3.00A {Thermus thermophilus} PDB: 1vsa_H 3d5d_N 3d5b_N 3f1h_N Length = 163 Back     alignment and structure
>3bbo_L Ribosomal protein L13; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 250 Back     alignment and structure
>2ftc_H L13MT, MRP-L13, 39S ribosomal protein L13, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} Length = 148 Back     alignment and structure
>1j3a_A 50S ribosomal protein L13P; rRNA binding, ribosomal assembly, ribosome; 1.60A {Pyrococcus horikoshii} SCOP: c.21.1.1 Length = 142 Back     alignment and structure
>4a17_I RPL13A, 60S ribosomal protein L13A; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_I 4a1c_I 4a1e_I Length = 198 Back     alignment and structure
>3jyw_M 60S ribosomal protein L16(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_M Length = 178 Back     alignment and structure
>1vq8_J 50S ribosomal protein L13P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.21.1.1 PDB: 1giy_M 1jj2_I 1k73_K* 1k8a_K* 1k9m_K* 1kc8_K* 1kd1_K* 1kqs_I* 1m1k_K* 1m90_K* 1ml5_m* 1n8r_K* 1nji_K* 1q7y_K* 1q81_K* 1q82_K* 1q86_K* 1qvf_I 1qvg_I 1s72_J* ... Length = 145 Back     alignment and structure
>2zkr_j 60S ribosomal protein L13A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 203 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
3v2d_N140 50S ribosomal protein L13; ribosome associated inh 99.98
2ftc_H148 L13MT, MRP-L13, 39S ribosomal protein L13, mitocho 99.98
3r8s_J142 50S ribosomal protein L13; protein biosynthesis, R 99.97
2zjr_G174 50S ribosomal protein L13; ribosome, large ribosom 99.97
3f1f_N163 50S ribosomal protein L13; RF2, ribosome, terminat 99.97
3r8n_I127 30S ribosomal protein S9; protein biosynthesis, RN 99.97
2vqe_I128 30S ribosomal protein S9, 30S ribosomal protein S6 99.97
3bbo_L250 Ribosomal protein L13; large ribosomal subunit, sp 99.96
2xzm_I145 RPS16E; ribosome, translation; 3.93A {Tetrahymena 99.96
3j20_K135 30S ribosomal protein S9P; archaea, archaeal, KINK 99.96
3u5c_Q143 RP61R, 40S ribosomal protein S16-A; translation, r 99.96
2zkq_i146 40S ribosomal protein S16E; protein-RNA complex, 4 99.95
3bbn_I197 Ribosomal protein S9; small ribosomal subunit, spi 99.95
1j3a_A142 50S ribosomal protein L13P; rRNA binding, ribosoma 99.93
4b6a_O199 60S ribosomal protein L16-A; large ribosomal subun 99.93
3iz6_I149 40S ribosomal protein S16 (S9P); eukaryotic riboso 99.92
1vq8_J145 50S ribosomal protein L13P; ribosome 50S, protein- 99.92
4a17_I198 RPL13A, 60S ribosomal protein L13A; eukaryotic rib 99.89
3iz5_K206 60S ribosomal protein L13A (L13P); eukaryotic ribo 99.87
2zkr_j203 60S ribosomal protein L13A; protein-RNA complex, 6 99.87
3jyw_M178 60S ribosomal protein L16(A); eukaryotic ribosome, 99.83
>3v2d_N 50S ribosomal protein L13; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_M 2hgj_M 2hgu_M 2j03_N 2jl6_N 2jl8_N 2v47_N 2v49_N 2wdi_N 2wdj_N 2wdl_N 2wdn_N 2wh2_N 2wh4_N 2wrj_N 2wrl_N 2wro_N 2wrr_N 2x9s_N 2x9u_N ... Back     alignment and structure
Probab=99.98  E-value=7.7e-34  Score=211.41  Aligned_cols=89  Identities=44%  Similarity=0.727  Sum_probs=83.3

Q ss_pred             CeEEEeCCCCchhhHHHHHHHHHhCCCceEEeeecc----------------------------ccCCCCeeeecccccc
Q psy9398           1 MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHID----------------------------TGYPGGIRKINFLKMQ   52 (154)
Q Consensus         1 ~w~viDa~~~~lGRlAs~vA~~L~Gk~k~~~~~~~d----------------------------~gy~gg~k~~~~~~~~   52 (154)
                      .|+||||+||+||||||+||++|+|||||+|+|+.|                            +|||||++++++++++
T Consensus        12 ~w~viDA~~~~LGRLAs~iAk~L~GKhKp~ytP~~d~Gd~VVViNaeki~~tG~k~~~K~yy~htgypGglk~~~~~~~~   91 (140)
T 3v2d_N           12 RWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKML   91 (140)
T ss_dssp             CEEEEECSSSBTTHHHHHHHHHHHTTTSTTCCTTSCCCCEEEEECGGGCBCCTTHHHHCEEEEECSSTTCEEEEEHHHHH
T ss_pred             eEEEEeCCCCchHHHHHHHHHHHcCCCCCccCCCccCCCEEEEEeCcceEccCchhhheeeEEecccCCcceeccHHHhh
Confidence            599999999999999999999999999999999997                            4799999999999999


Q ss_pred             ccCchhHHHHhhhhhhcccCccccccccceeeeecCcce
Q psy9398          53 EDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSGK   91 (154)
Q Consensus        53 ~r~P~~Il~raV~gmlp~~~~grrK~a~aRv~i~~G~g~   91 (154)
                      +++|++|+++||+||||++  .+++.++.|+++|+|+..
T Consensus        92 ~r~P~~ii~~aVrGMLPk~--~lgr~~l~rLkVy~G~~h  128 (140)
T 3v2d_N           92 ATHPERVLEHAVKGMLPKG--PLGRRLFKRLKVYAGPDH  128 (140)
T ss_dssp             HHCTHHHHHHHHHHTSCSS--HHHHHHHHTEEECSSSCC
T ss_pred             hhCHHHHHHHHHHhcCCCC--hhHHHHHhCCEEeCCCCC
Confidence            9999999999999999985  456788999999999863
>2ftc_H L13MT, MRP-L13, 39S ribosomal protein L13, mitochondrial; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} Back     alignment and structure
>3r8s_J 50S ribosomal protein L13; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 1p85_H 1p86_H 1vs8_J 1vs6_J 2aw4_J 2awb_J 2gya_H 2gyc_H 1vt2_J 2i2v_J 2i2t_J* 2qao_J* 2qba_J* 2qbc_J* 2qbe_J 2qbg_J 2qbi_J* 2qbk_J* 2qov_J 2qox_J ... Back     alignment and structure
>2zjr_G 50S ribosomal protein L13; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: c.21.1.1 PDB: 1nwx_H* 1nwy_H* 1sm1_H* 1xbp_H* 2zjp_G* 2zjq_G 1nkw_H 3cf5_G* 3dll_G* 3pio_G* 3pip_G* 1pnu_H 1pny_H 1vor_K 1vou_K 1vow_K 1voy_K 1vp0_K Back     alignment and structure
>3f1f_N 50S ribosomal protein L13; RF2, ribosome, termination, tRNA; 3.00A {Thermus thermophilus} PDB: 1vsa_H 3d5d_N 3d5b_N 3f1h_N Back     alignment and structure
>2vqe_I 30S ribosomal protein S9, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: d.14.1.1 PDB: 1gix_L* 1hnw_I* 1hnx_I* 1hnz_I* 1hr0_I 1i94_I* 1i95_I* 1i96_I* 1i97_I* 1ibk_I* 1ibl_I* 1ibm_I 1j5e_I 1jgo_L* 1jgp_L* 1jgq_L* 1ml5_L* 1n32_I* 1n33_I* 1n34_I ... Back     alignment and structure
>3bbo_L Ribosomal protein L13; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
>2xzm_I RPS16E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_I Back     alignment and structure
>3j20_K 30S ribosomal protein S9P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3u5c_Q RP61R, 40S ribosomal protein S16-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_I 3o30_J 3o2z_J 3u5g_Q 1s1h_I 3jyv_I* Back     alignment and structure
>2zkq_i 40S ribosomal protein S16E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3bbn_I Ribosomal protein S9; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1j3a_A 50S ribosomal protein L13P; rRNA binding, ribosomal assembly, ribosome; 1.60A {Pyrococcus horikoshii} SCOP: c.21.1.1 Back     alignment and structure
>3iz6_I 40S ribosomal protein S16 (S9P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1vq8_J 50S ribosomal protein L13P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.21.1.1 PDB: 1giy_M 1jj2_I 1k73_K* 1k8a_K* 1k9m_K* 1kc8_K* 1kd1_K* 1kqs_I* 1m1k_K* 1m90_K* 1ml5_m* 1n8r_K* 1nji_K* 1q7y_K* 1q81_K* 1q82_K* 1q86_K* 1qvf_I 1qvg_I 1s72_J* ... Back     alignment and structure
>4a17_I RPL13A, 60S ribosomal protein L13A; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_I 4a1c_I 4a1e_I Back     alignment and structure
>2zkr_j 60S ribosomal protein L13A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3jyw_M 60S ribosomal protein L16(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d2vqei1127 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus t 1e-22
d2gy9i1126 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherich 2e-21
d2j01n1139 c.21.1.1 (N:1-139) Ribosomal protein L13 {Thermus 3e-13
d2zjrg1142 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinoco 8e-13
d2gych1140 c.21.1.1 (H:1-140) Ribosomal protein L13 {Escheric 6e-11
d1vqoj1142 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon 1e-05
d1j3aa_142 c.21.1.1 (A:) Ribosomal protein L13 {Archaeon Pyro 2e-05
>d2vqei1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} Length = 127 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: Translational machinery components
domain: Ribosomal protein S9
species: Thermus thermophilus [TaxId: 274]

 Score = 84.6 bits (209), Expect = 1e-22
 Identities = 38/84 (45%), Positives = 52/84 (61%)

Query: 71  YGTGRRKSAIARVFIKIGSGKMTINRIPADKYFSRKTGLMVISQPLKLTKHTKTFDIKIN 130
           YGTGRRK A+ARVF++ G+GK+T+N    ++YF      +   +PL+       FD  I 
Sbjct: 4   YGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYIT 63

Query: 131 VRGGGESGQYGAVRHGITRAFNQL 154
           VRGGG+SGQ  A++ GI RA  Q 
Sbjct: 64  VRGGGKSGQIDAIKLGIARALVQY 87
>d2gy9i1 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]} Length = 126 Back     information, alignment and structure
>d2j01n1 c.21.1.1 (N:1-139) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]} Length = 139 Back     information, alignment and structure
>d2zjrg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]} Length = 142 Back     information, alignment and structure
>d2gych1 c.21.1.1 (H:1-140) Ribosomal protein L13 {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d1vqoj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 Back     information, alignment and structure
>d1j3aa_ c.21.1.1 (A:) Ribosomal protein L13 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d2zjrg1142 Ribosomal protein L13 {Deinococcus radiodurans [Ta 99.97
d2j01n1139 Ribosomal protein L13 {Thermus thermophilus [TaxId 99.97
d2gych1140 Ribosomal protein L13 {Escherichia coli [TaxId: 56 99.96
d2vqei1127 Ribosomal protein S9 {Thermus thermophilus [TaxId: 99.96
d2gy9i1126 Ribosomal protein S9 {Escherichia coli [TaxId: 562 99.96
d1vqoj1142 Ribosomal protein L13 {Archaeon Haloarcula marismo 99.89
d1j3aa_142 Ribosomal protein L13 {Archaeon Pyrococcus horikos 99.89
>d2zjrg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribosomal protein L13
superfamily: Ribosomal protein L13
family: Ribosomal protein L13
domain: Ribosomal protein L13
species: Deinococcus radiodurans [TaxId: 1299]

Probab=99.97  E-value=1.1e-32  Score=204.23  Aligned_cols=88  Identities=32%  Similarity=0.527  Sum_probs=82.5

Q ss_pred             CeEEEeCCCCchhhHHHHHHHHHhCCCceEEeeecc----------------------------ccCCCCeeeecccccc
Q psy9398           1 MWFLIDAKNKILGRVASKIAVYLRGKHKTEYTPHID----------------------------TGYPGGIRKINFLKMQ   52 (154)
Q Consensus         1 ~w~viDa~~~~lGRlAs~vA~~L~Gk~k~~~~~~~d----------------------------~gy~gg~k~~~~~~~~   52 (154)
                      .||||||+||+||||||.||++|+|||||+|+|+.|                            +|||||+++.++++++
T Consensus        11 ~W~viDA~~~~lGRlAs~iAk~L~GK~kp~y~p~~d~Gd~ViViNa~ki~~tG~K~~~k~y~~htg~pgg~k~~~~~~~~   90 (142)
T d2zjrg1          11 NWVVVDASGVPLGRLATLIASRIRGKHRPDFTPNMIQGDFVVVINAAQVALTGKKLDDKVYTRYTGYQGGLKTETAREAL   90 (142)
T ss_dssp             CEEEEECTTSBHHHHHHHHHHHHHCSSCSSCCSSSCCCCEEEEECCTTCBCSSCSSSSCEEEECCSSCSSCCEEEESTTT
T ss_pred             cEEEEECCCCchHHHHHHHHHHHhcCcccceeecccCCCEEEEcCCceeEEcCcchhhheehhhcccccccccccHHHHh
Confidence            599999999999999999999999999999999986                            5899999999999999


Q ss_pred             ccCchhHHHHhhhhhhcccCccccccccceeeeecCcc
Q psy9398          53 EDFPGRVLQKAVKVVNYKYGTGRRKSAIARVFIKIGSG   90 (154)
Q Consensus        53 ~r~P~~Il~raV~gmlp~~~~grrK~a~aRv~i~~G~g   90 (154)
                      +++|++|+++||+||||++.  +++.++.|+++|+|+.
T Consensus        91 ~r~P~~ii~~aV~gMLPkn~--lgr~~lkrLkvy~G~~  126 (142)
T d2zjrg1          91 SKHPERVIEHAVFGMLPKGR--QGRAMHTRLKVYAGET  126 (142)
T ss_dssp             TSCHHHHHHHHHGGGSCCSH--HHHHHHTTCEECSCST
T ss_pred             ccchHHHHHHHHHhcCCCCh--hHHHHHhCCeEeCCCC
Confidence            99999999999999999764  5677899999999974
>d2j01n1 c.21.1.1 (N:1-139) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gych1 c.21.1.1 (H:1-140) Ribosomal protein L13 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vqei1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gy9i1 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vqoj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1j3aa_ c.21.1.1 (A:) Ribosomal protein L13 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure