Diaphorina citri psyllid: psy939


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-------
MVKIFDGKVMGGTTVLNGLMYCRGDSSDYDEYEKLGATGWGYKNVLPYFLKSEHNLQYNYQSYSAQN
cccccccccccccHHHHHHHHHccccccHHHHHHcccccccccccHHHHHHHccccccccccccccc
*VKIFDGKVMGGTTVLNGLMYCRGDSSDYDEYEKLGATGWGYKNVLPYFLKSEH*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKIFDGKVMGGTTVLNGLMYCRGDSSDYDEYEKLGATGWGYKNVLPYFLKSEHNLQYNYQSYSAQN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Choline dehydrogenase Can catalyze the oxidation of choline to betaine aldehyde and betaine aldehyde to glycine betaine.confidentA7N2P9
Choline dehydrogenase Can catalyze the oxidation of choline to betaine aldehyde and betaine aldehyde to glycine betaine.confidentB5ZUG2
Glucose dehydrogenase [acceptor] Essential for cuticular modification during development.confidentP18173

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processprobable
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GPE, chain A
Confidence level:very confident
Coverage over the Query: 2-58
View the alignment between query and template
View the model in PyMOL