Diaphorina citri psyllid: psy9404


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MTIKSDNWIHNMAKYHGMIEPFVPHQVREINSRKIVSYGISSYGYDIRCANEFKIFTNINSTIIDPKNFDNKLFVDFVGDVCIIPPNSFVLARTIEYFRIPRKILTMCIGKSTYARCGIIVNVTPFEPEWEGYVTLEFSNTTPLPAKIYSEEGCAQVLFFESDETCKTSYKDRNGKYQGQTGINLPKI
cccccHHHHHHHHHcccCECcccccccEECcccccccccccEEEEEEEEccCEEEEEccccCEEcccccccccEEECcccEEEEccccEEEEEEEEEEEEcccEEEEEEcccccCEEcEEEEccCCcccccEEEEEEEECcccccEEEEcccCEEEEEEEECcccccccccccccccccccccccccc
*TIKSDNWIHNMAKYHGMIEPFVPHQVREINSRKIVSYGISSYGYDIRCANEFKIFTNINSTIIDPKNFDNKLFVDFVGDVCIIPPNSFVLARTIEYFRIPRKILTMCIGKSTYARCGIIVNVTPFEPEWEGYVTLEFSNTTPLPAKIYSEEGCAQVLFFESDETC*******************P**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIKSDNWIHNMAKYHGMIEPFVPHQVREINSRKIVSYGISSYGYDIRCANEFKIFTNINSTIIDPKNFDNKLFVDFVGDVCIIPPNSFVLARTIEYFRIPRKILTMCIGKSTYARCGIIVNVTPFEPEWEGYVTLEFSNTTPLPAKIYSEEGCAQVLFFESDETCKTSYKDRNGKYQGQTGINLPKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Deoxycytidine triphosphate deaminase very confidentQ143I2
Deoxycytidine triphosphate deaminase very confidentP63904
Deoxycytidine triphosphate deaminase very confidentB2UA12

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008829 [MF]dCTP deaminase activityprobableGO:0016787, GO:0016810, GO:0016814, GO:0003824, GO:0019239, GO:0003674
GO:0006253 [BP]dCTP catabolic processprobableGO:0009149, GO:0009213, GO:0046434, GO:0009211, GO:0009219, GO:0009143, GO:0006139, GO:0009147, GO:0009166, GO:0072529, GO:0034641, GO:0006807, GO:0044281, GO:0046065, GO:1901360, GO:1901361, GO:0006220, GO:0009394, GO:1901575, GO:0046386, GO:0046483, GO:0071704, GO:0006244, GO:0009141, GO:0072527, GO:0009204, GO:0009200, GO:0009987, GO:0006725, GO:0044710, GO:0009223, GO:0046700, GO:0019439, GO:0009262, GO:0009117, GO:0009264, GO:0008152, GO:0034655, GO:0009056, GO:0055086, GO:1901565, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0044237, GO:0019692, GO:0006796, GO:0044238, GO:1901292, GO:0006793, GO:0019637, GO:0008150, GO:0006753
GO:0033973 [MF]dCTP deaminase (dUMP-forming) activityprobableGO:0016787, GO:0016810, GO:0016814, GO:0003824, GO:0019239, GO:0003674
GO:0004170 [MF]dUTP diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0047429

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
3.5.4.-4'-demethylrebeccamycin synthase.probable
3.5.4.13dCTP deaminase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DHK, chain A
Confidence level:very confident
Coverage over the Query: 3-172
View the alignment between query and template
View the model in PyMOL