Diaphorina citri psyllid: psy9414

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--
MRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDARKRYYLRKKRLFHEKKENYAKLKKATIQFKKNNRETQKSLIEMAVKRIKELKNKENKKIK
ccccccccccEEEEEccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccEEEEEccccccEEEHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccEEEEEccEEEEEEEcccccEEEEEccccccccccccccCEEEccccEEEEEcccccccccccccccccccccccccEEEEcccEEEEEEEEEEcccccEEEEEEEECccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccccccccccccccEEEEEEECcccccccccccccEEEccCEEECcccccccccccccEEEccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHccccccccccccccEEEEEEECcccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccc
*RSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTK*SSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDARKRYYLRKKRLFHEKKENYAKLKK***************LIEMAVK**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDARKRYYLRKKRLFHEKKENYAKLKKATIQFKKNNxxxxxxxxxxxxxxxxxxxxxENKKIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamine--tRNA ligase confidentQ7VU94
Glutamine--tRNA ligase confidentA4SZM1
Glutamine--tRNA ligase confidentQ0K808

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.18Glutamine--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HZ7, chain A
Confidence level:very confident
Coverage over the Query: 1-383
View the alignment between query and template
View the model in PyMOL
Template: 1JB0, chain C
Confidence level:very confident
Coverage over the Query: 447-505
View the alignment between query and template
View the model in PyMOL
Template: 3C8Y, chain A
Confidence level:confident
Coverage over the Query: 398-503
View the alignment between query and template
View the model in PyMOL