Psyllid ID: psy9414

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--

MRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDARKRYYLRKKRLFHEKKENYAKLKKATIQFKKNNRETQKSLIEMAVKRIKELKNKENKKIK

ccccccccccEEEEEccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccEEEEEccccccEEEHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccEEEEEccEEEEEEEcccccEEEEEccccccccccccccEEEEccccEEEEEcccccccccccccccccccccccccEEEEcccEEEEEEEEEEcccccEEEEEEEEEccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccccccccccccccEEEEEEEEcccccccccccccEEEccEEEEEcccccccccccccEEEccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHccccccccccccccEEEEEEEEccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccc

ccccccccccEEEEEEEEcccccccccccEEEEEEEcccccccccEEEEccccccccHHHHHHcccccEEEEEccccccHHHHHHHHcccccccccccccEEEEEHEccEEEHHcHHHHHHHHHccccccccccccccHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccEEEEEccEEEEEEccccccEEEEEcccccccccccccccEEEcccEEEEEEHHHHccccccccEEcccccccccccEEEEEEEEEEEEEEEEEcccccEEEEEEEEccccccccccccccEEEEEEEEEEHHccccHHEEEHHHHcccccccccccccHHHHHccccEEEEEEEEcccHHHccccccEEEEEEEccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHcccccEcccEcccccccEEEEEEcccccEcEEEEccccHHHHHHHHHHHHHHHHHHccccccEEccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccc

mrsgefkdgaHVLRVKINMkskninmrdpiiYRIRHVnhyrtnnnwciypmydyahpisDAIENITHsictlefqdhrpFYEWILNKidktnfikrpfpkqyefsrlnlTHTITSKRKLLKLLEKKIvdgwddprmptligmrrrgytpeSIKLFCKRigvsksdswINIEILEQALRddldikapriMAVLNPIKLIISNfldnqeiectaplfsrqhtqykeklryfpiskilwierddfmeiptkkyfrlyppigknsgnrvrLRYGYVVECtgfkknknneVVEVYCKyfpdsksgtklssnykvkgnIHWISKSHALSIEARLYdrlfidpypnivnnkdfkllinpnSKKVISAYlepnlklifpkkhaqfeqnllpqtqctkcgypgcRQYAEAIANKkanynqcptggrkGIIKLAKYlnkpiiplntiygnekSRCCAIikenkcigctlciqscpvDAIIGAAKHMHTIFSKLctgcdlcikkcpvncismievtpcrtgwdawsqKKADDARKRYYLRKKRLFHEKKENYAKLKKATIQFKKNNRETQKSLIEMAVKRIKELKNKENKKIK

mrsgefkdgahVLRVKinmkskninmrdpiIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKqyefsrlnlthtitskRKLLKLLEkkivdgwddprmptligmrrrgytpeSIKLFCKrigvsksdswINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAplfsrqhtqykekLRYFPISKILWIERDDFMEIPTKkyfrlyppigknsgnrvrLRYGYVVEctgfkknknnevVEVYCKyfpdsksgtklssnykVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIevtpcrtgwdawsqkkaddaRKRYYLRKkrlfhekkenyaklkkatiqfkknnretqksLIEMAVKRikelknkenkkik

MRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSkrkllkllekkIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDArkryylrkkrlFHEKKENYAKLKKATIQFKKNNRETQKSLIEMAVkrikelknkenkkik

**********HVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDARKRYYLRKKRLFHEKKENYAKLK*************************************

*RSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFP***************GNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKK****************************************AIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQ*****ARKRYYLRKKRLFHEKKENYAKLKK***************LIEMAVK**************

******KDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQH***KEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTK*SSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDARKRYYLRKKRLFHEKKENYAKLKKATIQFKKNNRETQKSLIEMAVKRIKELKNKEN****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		582	2.2.26 [Sep-21-2011]
B1XW11		590	Glutamine--tRNA ligase OS	yes	N/A	0.666	0.657	0.578	1e-136
A4SZM1		590	Glutamine--tRNA ligase OS	yes	N/A	0.644	0.635	0.585	1e-136
Q1LQ72		582	Glutamine--tRNA ligase OS	yes	N/A	0.635	0.635	0.563	1e-131
B3R5N3		585	Glutamine--tRNA ligase OS	yes	N/A	0.635	0.632	0.560	1e-131
Q8Y199		580	Glutamine--tRNA ligase OS	yes	N/A	0.635	0.637	0.557	1e-131
Q0K808		585	Glutamine--tRNA ligase OS	yes	N/A	0.635	0.632	0.560	1e-131
B2U846		576	Glutamine--tRNA ligase OS	yes	N/A	0.635	0.642	0.560	1e-131
Q7VU94		587	Glutamine--tRNA ligase OS	yes	N/A	0.632	0.626	0.559	1e-129
Q7W4T0		587	Glutamine--tRNA ligase OS	yes	N/A	0.632	0.626	0.559	1e-128
Q7WGA6		587	Glutamine--tRNA ligase OS	yes	N/A	0.632	0.626	0.556	1e-128

>sp\|B1XW11\|SYQ_POLNS Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=glnS PE=3 SV=1	Back alignment and function desciption

 Score =  485 bits (1248), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 229/396 (57%), Positives = 297/396 (75%), Gaps = 8/396 (2%)

Query: 1   MRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISD 60
           MR G+FKDG HVLR+KI+M   NI MRDP++YRIRH +H+RT + WCIYP+YD+ H ISD
Sbjct: 187 MRDGKFKDGEHVLRLKIDMAHPNIVMRDPVVYRIRHTDHHRTGSKWCIYPLYDFTHCISD 246

Query: 61  AIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLL 120
           A+ENI+HSICTLEF+++RP Y+WI+N + +    K P P Q+EF+RLNLT+TITSKRKLL
Sbjct: 247 ALENISHSICTLEFENNRPLYDWIVNSLKELGVFKDPVPHQHEFARLNLTYTITSKRKLL 306

Query: 121 KLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDD 180
           +L+E+K V+GWDDPRMPT++G+RRRGYTPESI+LFC+RIGVSK+DSWI++  L+QALRDD
Sbjct: 307 QLVEEKHVEGWDDPRMPTIVGIRRRGYTPESIRLFCERIGVSKADSWIDMSTLDQALRDD 366

Query: 181 LDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKE-KLRYFPISKILWIER 239
           L+++APR  AVL P+KL++ NF    +  C+AP    +H  Y E   R F  ++ LWIE 
Sbjct: 367 LEVRAPRATAVLKPLKLVVENFDAPTKEACSAP----RHPNYPEWGNREFNFTRELWIEA 422

Query: 240 DDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKS 299
           DDFM+ P K +FRLYPPI    G+RVRLR+G+VVECTGF+ +    V +V   +FPDSKS
Sbjct: 423 DDFMQEPIKGFFRLYPPIDDQPGSRVRLRHGFVVECTGFETDAQGNVTQVNVTHFPDSKS 482

Query: 300 GTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVIS 359
           GT  S+NYKVKGNIHWIS + A+  E RLYD LF DPYP+   +K+F   INPNSK+ IS
Sbjct: 483 GTPGSNNYKVKGNIHWISAAEAIPAEVRLYDHLFTDPYPD-SGDKNFLDAINPNSKQTIS 541

Query: 360 AYLEPNLKLIFPKKHAQFEQN--LLPQTQCTKCGYP 393
           AYLEP +K    +   QFE++   +     +K G P
Sbjct: 542 AYLEPCMKDAKAEDRFQFERHGYFVADQSDSKPGKP 577

Polynucleobacter necessarius subsp. necessarius (strain STIR1) (taxid: 452638)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 8

>sp\|A4SZM1\|SYQ_POLSQ Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q1LQ72\|SYQ_RALME Glutamine--tRNA ligase OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|B3R5N3\|SYQ_CUPTR Glutamine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q8Y199\|SYQ_RALSO Glutamine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q0K808\|SYQ_CUPNH Glutamine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|B2U846\|SYQ_RALPJ Glutamine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q7VU94\|SYQ_BORPE Glutamine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q7W4T0\|SYQ_BORPA Glutamine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q7WGA6\|SYQ_BORBR Glutamine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glnS PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		582
340786344		591	glutaminyl-tRNA synthetase [Collimonas f	0.651	0.641	0.628	1e-153
134093864		582	glutaminyl-tRNA synthetase [Herminiimona	0.656	0.656	0.611	1e-148
395761173		588	glutaminyl-tRNA ligase [Janthinobacteriu	0.644	0.637	0.614	1e-147
152980200		582	glutaminyl-tRNA synthetase [Janthinobact	0.634	0.634	0.608	1e-147
237746870		588	glutaminyl-tRNA synthetase [Oxalobacter	0.634	0.627	0.626	1e-146
237749019		585	glutaminyl-tRNA synthetase [Oxalobacter	0.634	0.630	0.616	1e-144
329901659		578	Glutaminyl-tRNA synthetase [Oxalobactera	0.634	0.638	0.614	1e-143
399017430		604	glutaminyl-tRNA synthetase [Herbaspirill	0.640	0.617	0.602	1e-141
445495342		588	glutamine-tRNA ligase GlnS [Janthinobact	0.644	0.637	0.596	1e-140
300312914		583	glutaminyl-tRNA synthetase [Herbaspirill	0.640	0.639	0.6	1e-140

>gi\|340786344\|ref\|YP_004751809.1\| glutaminyl-tRNA synthetase [Collimonas fungivorans Ter331] gi\|340551611\|gb\|AEK60986.1\| Glutaminyl-tRNA synthetase [Collimonas fungivorans Ter331]	Back alignment and taxonomy information

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 239/380 (62%), Positives = 304/380 (80%), Gaps = 1/380 (0%)

Query: 1   MRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISD 60
           M++GEFKDG H++R +I+M S N+N+RDP IYRIRH +H+RT + WCIYPMYDY HPISD
Sbjct: 184 MKAGEFKDGEHIVRARIDMASPNMNLRDPAIYRIRHAHHHRTGDKWCIYPMYDYTHPISD 243

Query: 61  AIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLL 120
           A+ENI+HSICTLEFQDHRPFY+W+L  +    F+++P P QYEFSRLN+T+ ITSKRKL 
Sbjct: 244 ALENISHSICTLEFQDHRPFYDWLLEHLSSAGFLQKPVPHQYEFSRLNVTYVITSKRKLR 303

Query: 121 KLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDD 180
           +L+++ IVDGWDDPRMPTL+G+RRRG+TPES++LFC R GV+KSD WI++  LE ALR+D
Sbjct: 304 QLVDEGIVDGWDDPRMPTLVGIRRRGFTPESLQLFCDRTGVTKSDGWIDMSSLEGALRED 363

Query: 181 LDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERD 240
           LD KAPR  AVL P+KLII NF + + + C AP++   H ++   LR+FPISK LWIE++
Sbjct: 364 LDPKAPRASAVLQPLKLIIDNFPEGETVACHAPVYPPAHPEHATALRHFPISKTLWIEQE 423

Query: 241 DFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSG 300
           DFME P K YFRL+PP     G+RVRLR+GYVVECTGF K+ + +V  V+C YFPDSKSG
Sbjct: 424 DFMETPVKGYFRLFPPSADKPGSRVRLRHGYVVECTGFDKDADGKVTAVHCTYFPDSKSG 483

Query: 301 TKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISA 360
           T+ S+NYKVKGNIHWIS +HA+  E RLYDRLF DP+P+    KDFK  +NP++KKVISA
Sbjct: 484 TEGSANYKVKGNIHWISVAHAIEAEVRLYDRLFTDPHPD-AGGKDFKAALNPDAKKVISA 542

Query: 361 YLEPNLKLIFPKKHAQFEQN 380
           YLEP LK   P++  QFE++
Sbjct: 543 YLEPGLKDAQPEQRYQFERH 562

Source: Collimonas fungivorans Ter331

Species: Collimonas fungivorans

Genus: Collimonas

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi\|134093864\|ref\|YP_001098939.1\| glutaminyl-tRNA synthetase [Herminiimonas arsenicoxydans] gi\|133737767\|emb\|CAL60812.1\| glutamine tRNA synthetase (Glutamine--tRNA ligase) (GlnRS) [Herminiimonas arsenicoxydans]	Back alignment and taxonomy information

>gi\|395761173\|ref\|ZP_10441842.1\| glutaminyl-tRNA ligase [Janthinobacterium lividum PAMC 25724]	Back alignment and taxonomy information

>gi\|152980200\|ref\|YP_001352269.1\| glutaminyl-tRNA synthetase [Janthinobacterium sp. Marseille] gi\|151280277\|gb\|ABR88687.1\| Glutaminyl-tRNA synthetase [Janthinobacterium sp. Marseille]	Back alignment and taxonomy information

>gi\|237746870\|ref\|ZP_04577350.1\| glutaminyl-tRNA synthetase [Oxalobacter formigenes HOxBLS] gi\|229378221\|gb\|EEO28312.1\| glutaminyl-tRNA synthetase [Oxalobacter formigenes HOxBLS]	Back alignment and taxonomy information

>gi\|237749019\|ref\|ZP_04579499.1\| glutaminyl-tRNA synthetase [Oxalobacter formigenes OXCC13] gi\|229380381\|gb\|EEO30472.1\| glutaminyl-tRNA synthetase [Oxalobacter formigenes OXCC13]	Back alignment and taxonomy information

>gi\|329901659\|ref\|ZP_08272873.1\| Glutaminyl-tRNA synthetase [Oxalobacteraceae bacterium IMCC9480] gi\|327549049\|gb\|EGF33654.1\| Glutaminyl-tRNA synthetase [Oxalobacteraceae bacterium IMCC9480]	Back alignment and taxonomy information

>gi\|399017430\|ref\|ZP_10719622.1\| glutaminyl-tRNA synthetase [Herbaspirillum sp. CF444] gi\|398103304\|gb\|EJL93475.1\| glutaminyl-tRNA synthetase [Herbaspirillum sp. CF444]	Back alignment and taxonomy information

>gi\|445495342\|ref\|ZP_21462386.1\| glutamine-tRNA ligase GlnS [Janthinobacterium sp. HH01] gi\|444791503\|gb\|ELX13050.1\| glutamine-tRNA ligase GlnS [Janthinobacterium sp. HH01]	Back alignment and taxonomy information

>gi\|300312914\|ref\|YP_003777006.1\| glutaminyl-tRNA synthetase [Herbaspirillum seropedicae SmR1] gi\|300075699\|gb\|ADJ65098.1\| glutaminyl-tRNA synthetase protein [Herbaspirillum seropedicae SmR1]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		582
TIGR_CMR\|GSU_3366		554	GSU_3366 "glutaminyl-tRNA synt	0.554	0.583	0.511	5.9e-89
UNIPROTKB\|Q9KTA6		556	glnS "Glutamine--tRNA ligase"	0.620	0.649	0.460	5e-83
TIGR_CMR\|VC_0997		556	VC_0997 "glutaminyl-tRNA synth	0.620	0.649	0.460	5e-83
UNIPROTKB\|P00962		554	glnS "glutaminyl-tRNA syntheta	0.618	0.649	0.463	1e-82
TIGR_CMR\|SO_1786		556	SO_1786 "glutaminyl-tRNA synth	0.627	0.656	0.432	2.7e-77
TIGR_CMR\|CPS_3240		556	CPS_3240 "glutaminyl-tRNA synt	0.621	0.651	0.434	3.1e-76
DICTYBASE\|DDB_G0289481		779	glnS "glutamine-tRNA ligase" [	0.596	0.445	0.367	5.9e-57
ZFIN\|ZDB-GENE-040426-1011		797	qars "glutaminyl-tRNA syntheta	0.597	0.436	0.369	2.3e-52
UNIPROTKB\|E2QRQ8		775	QARS "Uncharacterized protein"	0.601	0.451	0.350	3.3e-52
FB\|FBgn0027090		778	Aats-gln "Glutaminyl-tRNA synt	0.604	0.452	0.339	2.3e-51

TIGR_CMR\|GSU_3366 GSU_3366 "glutaminyl-tRNA synthetase" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

 Score = 888 (317.7 bits), Expect = 5.9e-89, P = 5.9e-89
 Identities = 174/340 (51%), Positives = 228/340 (67%)

Query:     1 MRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISD 60
             MR+GEF DGA VLR +I+M S NIN+RDP++YRI H  H    + WCIYPMYDYAH  SD
Sbjct:   162 MRAGEFPDGAKVLRARIDMASPNINLRDPVMYRILHAPHPHAGDKWCIYPMYDYAHGQSD 221

Query:    61 AIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSXXXXX 120
             AIE ITHSICTLEF+DH+P YEW L+ +   N   RP  +QYEF+RLNLT+ + S     
Sbjct:   222 AIEGITHSICTLEFEDHKPLYEWFLDNLPVPN---RP--RQYEFARLNLTYAVMSKRKLL 276

Query:   121 XXXXXXIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDD 180
                    V GWDDPRMPT++G+RRRG+TPE+I+ FC  IGV +SDSWI++ ILE+++R D
Sbjct:   277 QLVKDGDVTGWDDPRMPTIMGIRRRGFTPEAIRNFCDTIGVGRSDSWIDMSILEESVRQD 336

Query:   181 LDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEK-LRYFPISKILWIER 239
             L+ +APR+MAVL P++L+I N+ +      T  L    H Q  +   R  P  + L+IER
Sbjct:   337 LNERAPRVMAVLRPLRLVIENYPEG----ATEDLTIAYHPQRPDLGSRSVPFGRELFIER 392

Query:   240 DDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKS 299
             DDFME+P K + RL P      G  +RLR  Y+V+CTG +++    V  V C Y P+++S
Sbjct:   393 DDFMEVPPKGFKRLSP------GEEIRLRGAYIVKCTGVERDGEGNVTTVRCTYDPETRS 446

Query:   300 GTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPN 339
             G    S  KVKG IHW+S +HA++ E RLYDRLF  P P+
Sbjct:   447 GLP-GSERKVKGVIHWVSATHAVTAEVRLYDRLFTVPNPS 485

GO:0004819 "glutamine-tRNA ligase activity" evidence=ISS

GO:0006425 "glutaminyl-tRNA aminoacylation" evidence=ISS

UNIPROTKB\|Q9KTA6 glnS "Glutamine--tRNA ligase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_0997 VC_0997 "glutaminyl-tRNA synthetase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

UNIPROTKB\|P00962 glnS "glutaminyl-tRNA synthetase" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_1786 SO_1786 "glutaminyl-tRNA synthetase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_3240 CPS_3240 "glutaminyl-tRNA synthetase" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0289481 glnS "glutamine-tRNA ligase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1011 qars "glutaminyl-tRNA synthetase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QRQ8 QARS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

FB\|FBgn0027090 Aats-gln "Glutaminyl-tRNA synthetase" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
B0U6D0	SYQ_XYLFM	6, ., 1, ., 1, ., 1, 8	0.4605	0.6340	0.6362	yes	N/A
Q5F7G0	SYQ_NEIG1	6, ., 1, ., 1, ., 1, 8	0.4895	0.6271	0.6494	yes	N/A
Q7VU94	SYQ_BORPE	6, ., 1, ., 1, ., 1, 8	0.5593	0.6323	0.6269	yes	N/A
Q87RG4	SYQ_VIBPA	6, ., 1, ., 1, ., 1, 8	0.4710	0.6202	0.6492	yes	N/A
Q7UX42	SYQ_RHOBA	6, ., 1, ., 1, ., 1, 8	0.4684	0.6237	0.6039	yes	N/A
Q8PNZ5	SYQ_XANAC	6, ., 1, ., 1, ., 1, 8	0.4568	0.6357	0.6390	yes	N/A
B5XZG7	SYQ_KLEP3	6, ., 1, ., 1, ., 1, 8	0.4736	0.6202	0.6504	yes	N/A
Q7NX86	SYQ_CHRVO	6, ., 1, ., 1, ., 1, 8	0.4817	0.6237	0.6482	yes	N/A
A4SZM1	SYQ_POLSQ	6, ., 1, ., 1, ., 1, 8	0.5853	0.6443	0.6355	yes	N/A
Q4QK64	SYQ_HAEI8	6, ., 1, ., 1, ., 1, 8	0.4736	0.6185	0.6463	yes	N/A
A5F2T1	SYQ_VIBC3	6, ., 1, ., 1, ., 1, 8	0.4645	0.6185	0.6474	yes	N/A
B5BCC3	SYQ_SALPK	6, ., 1, ., 1, ., 1, 8	0.4763	0.6202	0.6504	yes	N/A
Q0K808	SYQ_CUPNH	6, ., 1, ., 1, ., 1, 8	0.5605	0.6357	0.6324	yes	N/A
C3LTP5	SYQ_VIBCM	6, ., 1, ., 1, ., 1, 8	0.4645	0.6185	0.6474	yes	N/A
Q8ZQX5	SYQ_SALTY	6, ., 1, ., 1, ., 1, 8	0.4763	0.6202	0.6504	yes	N/A
A6T6C3	SYQ_KLEP7	6, ., 1, ., 1, ., 1, 8	0.4736	0.6202	0.6504	yes	N/A
Q8Y199	SYQ_RALSO	6, ., 1, ., 1, ., 1, 8	0.5578	0.6357	0.6379	yes	N/A
A9MUG5	SYQ_SALPB	6, ., 1, ., 1, ., 1, 8	0.4722	0.6219	0.6522	yes	N/A
A6VP11	SYQ_ACTSZ	6, ., 1, ., 1, ., 1, 8	0.4763	0.6185	0.6440	yes	N/A
B3R5N3	SYQ_CUPTR	6, ., 1, ., 1, ., 1, 8	0.5605	0.6357	0.6324	yes	N/A
Q188C8	SYQ_CLOD6	6, ., 1, ., 1, ., 1, 8	0.4779	0.6185	0.6498	yes	N/A
Q4UR70	SYQ_XANC8	6, ., 1, ., 1, ., 1, 8	0.4543	0.6357	0.6390	yes	N/A
Q87YQ1	SYQ_PSESM	6, ., 1, ., 1, ., 1, 8	0.4687	0.6168	0.6309	yes	N/A
Q3BX52	SYQ_XANC5	6, ., 1, ., 1, ., 1, 8	0.4568	0.6357	0.6390	yes	N/A
Q1LQ72	SYQ_RALME	6, ., 1, ., 1, ., 1, 8	0.5631	0.6357	0.6357	yes	N/A
Q88IU5	SYQ_PSEPK	6, ., 1, ., 1, ., 1, 8	0.4855	0.6219	0.6384	yes	N/A
Q2NZL7	SYQ_XANOM	6, ., 1, ., 1, ., 1, 8	0.4517	0.6357	0.6390	yes	N/A
Q2KVX0	SYQ_BORA1	6, ., 1, ., 1, ., 1, 8	0.5488	0.6323	0.6279	yes	N/A
P43831	SYQ_HAEIN	6, ., 1, ., 1, ., 1, 8	0.4710	0.6185	0.6463	yes	N/A
B1XW11	SYQ_POLNS	6, ., 1, ., 1, ., 1, 8	0.5782	0.6666	0.6576	yes	N/A
Q7W4T0	SYQ_BORPA	6, ., 1, ., 1, ., 1, 8	0.5593	0.6323	0.6269	yes	N/A
Q5GWF4	SYQ_XANOR	6, ., 1, ., 1, ., 1, 8	0.4517	0.6357	0.6390	yes	N/A
Q8XMP3	SYQ_CLOPE	6, ., 1, ., 1, ., 1, 8	0.4881	0.6168	0.6503	yes	N/A
Q9PDP1	SYQ_XYLFA	6, ., 1, ., 1, ., 1, 8	0.4631	0.6340	0.6362	yes	N/A
A5N6Y3	SYQ_CLOK5	6, ., 1, ., 1, ., 1, 8	0.4656	0.6460	0.6762	yes	N/A
B5R651	SYQ_SALG2	6, ., 1, ., 1, ., 1, 8	0.4763	0.6202	0.6504	yes	N/A
Q0TTG1	SYQ_CLOP1	6, ., 1, ., 1, ., 1, 8	0.4881	0.6168	0.6503	yes	N/A
P57000	SYQ_NEIMA	6, ., 1, ., 1, ., 1, 8	0.4973	0.6271	0.6494	yes	N/A
Q89KR6	SYQ_BRAJA	6, ., 1, ., 1, ., 1, 8	0.4684	0.6202	0.6469	yes	N/A
Q8PCB3	SYQ_XANCP	6, ., 1, ., 1, ., 1, 8	0.4543	0.6357	0.6390	yes	N/A
Q87DU6	SYQ_XYLFT	6, ., 1, ., 1, ., 1, 8	0.4631	0.6340	0.6362	yes	N/A
B2U846	SYQ_RALPJ	6, ., 1, ., 1, ., 1, 8	0.5605	0.6357	0.6423	yes	N/A
C0PWA7	SYQ_SALPC	6, ., 1, ., 1, ., 1, 8	0.4763	0.6202	0.6504	yes	N/A
Q5PCH8	SYQ_SALPA	6, ., 1, ., 1, ., 1, 8	0.4763	0.6202	0.6504	yes	N/A
B4TB84	SYQ_SALHS	6, ., 1, ., 1, ., 1, 8	0.4763	0.6202	0.6504	yes	N/A
Q9KTA6	SYQ_VIBCH	6, ., 1, ., 1, ., 1, 8	0.4645	0.6185	0.6474	yes	N/A
Q81ZS7	SYQ_NITEU	6, ., 1, ., 1, ., 1, 8	0.5497	0.6271	0.6564	yes	N/A
Q0SVB1	SYQ_CLOPS	6, ., 1, ., 1, ., 1, 8	0.4934	0.6168	0.6503	yes	N/A
Q7WGA6	SYQ_BORBR	6, ., 1, ., 1, ., 1, 8	0.5567	0.6323	0.6269	yes	N/A
P56927	SYQ_NEIMB	6, ., 1, ., 1, ., 1, 8	0.4947	0.6271	0.6494	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	6.1.1.18	0.824
3rd Layer	6.1.1	0.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		582
PRK05347		554	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Pr	0.0
PRK14703		771	PRK14703, PRK14703, glutaminyl-tRNA synthetase/Yqe	1e-157
TIGR00440		522	TIGR00440, glnS, glutaminyl-tRNA synthetase	1e-120
PLN02859		788	PLN02859, PLN02859, glutamine-tRNA ligase	1e-99
PRK06991		270	PRK06991, PRK06991, ferredoxin; Provisional	4e-89
PTZ00437		574	PTZ00437, PTZ00437, glutaminyl-tRNA synthetase; Pr	2e-79
cd00807		238	cd00807, GlnRS_core, catalytic core domain of glut	1e-77
PRK05113		191	PRK05113, PRK05113, electron transport complex pro	9e-61
COG2878		198	COG2878, COG2878, Predicted NADH:ubiquinone oxidor	1e-57
COG0008		472	COG0008, GlnS, Glutamyl- and glutaminyl-tRNA synth	1e-55
TIGR01944		165	TIGR01944, rnfB, electron transport complex, RnfAB	4e-55
pfam00749		314	pfam00749, tRNA-synt_1c, tRNA synthetases class I	1e-53
PRK08764		135	PRK08764, PRK08764, ferredoxin; Provisional	2e-48
pfam03950		174	pfam03950, tRNA-synt_1c_C, tRNA synthetases class	3e-48
PRK04156		567	PRK04156, gltX, glutamyl-tRNA synthetase; Provisio	2e-42
TIGR00463		556	TIGR00463, gltX_arch, glutamyl-tRNA synthetase, ar	1e-39
PLN02907		722	PLN02907, PLN02907, glutamate-tRNA ligase	5e-36
PTZ00402		601	PTZ00402, PTZ00402, glutamyl-tRNA synthetase; Prov	2e-34
PLN03233		523	PLN03233, PLN03233, putative glutamate-tRNA ligase	2e-33
cd00418		230	cd00418, GlxRS_core, catalytic core domain of glut	1e-27
cd09287		240	cd09287, GluRS_non_core, catalytic core domain of	2e-23
PRK07118		280	PRK07118, PRK07118, ferredoxin; Validated	1e-17
pfam04060		35	pfam04060, FeS, Putative Fe-S cluster	2e-10
COG1145		99	COG1145, NapF, Ferredoxin [Energy production and c	2e-10
COG1146		68	COG1146, COG1146, Ferredoxin [Energy production an	2e-09
PRK05888		164	PRK05888, PRK05888, NADH dehydrogenase subunit I;	3e-09
pfam13187		44	pfam13187, Fer4_9, 4Fe-4S dicluster domain	3e-09
PRK07118		280	PRK07118, PRK07118, ferredoxin; Validated	4e-09
COG1144		91	COG1144, COG1144, Pyruvate:ferredoxin oxidoreducta	4e-08
COG1149		284	COG1149, COG1149, MinD superfamily P-loop ATPase c	7e-08
TIGR02179		78	TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoredu	2e-07
pfam12838		48	pfam12838, Fer4_7, 4Fe-4S dicluster domain	2e-07
pfam13237		51	pfam13237, Fer4_10, 4Fe-4S dicluster domain	6e-07
TIGR01971		122	TIGR01971, NuoI, NADH-quinone oxidoreductase, chai	6e-07
PRK08318		420	PRK08318, PRK08318, dihydropyrimidine dehydrogenas	9e-07
PRK12771		564	PRK12771, PRK12771, putative glutamate synthase (N	2e-06
PRK13795		636	PRK13795, PRK13795, hypothetical protein; Provisio	3e-06
TIGR02512		374	TIGR02512, FeFe_hydrog_A, [FeFe] hydrogenase, grou	5e-06
COG1143		172	COG1143, NuoI, Formate hydrogenlyase subunit 6/NAD	6e-06
PRK09623		105	PRK09623, vorD, 2-ketoisovalerate ferredoxin oxido	7e-06
pfam13183		54	pfam13183, Fer4_8, 4Fe-4S dicluster domain	1e-05
TIGR04041		276	TIGR04041, activase_YjjW, glycine radical enzyme a	2e-05
COG1245		591	COG1245, COG1245, Predicted ATPase, RNase L inhibi	5e-05
PRK09898		208	PRK09898, PRK09898, hypothetical protein; Provisio	7e-05
TIGR00403		183	TIGR00403, ndhI, NADH-plastoquinone oxidoreductase	9e-05
COG1456		467	COG1456, CdhE, CO dehydrogenase/acetyl-CoA synthas	1e-04
PRK13409		590	PRK13409, PRK13409, putative ATPase RIL; Provision	1e-04
pfam13484		67	pfam13484, Fer4_16, 4Fe-4S double cluster binding	2e-04
PRK08348		120	PRK08348, PRK08348, NADH-plastoquinone oxidoreduct	2e-04
CHL00014		167	CHL00014, ndhI, NADH dehydrogenase subunit I	2e-04
COG4231		640	COG4231, COG4231, Indolepyruvate ferredoxin oxidor	2e-04
PRK04165		450	PRK04165, PRK04165, acetyl-CoA decarbonylase/synth	2e-04
PRK09624		105	PRK09624, porD, pyuvate ferredoxin oxidoreductase	3e-04
COG2221		317	COG2221, DsrA, Dissimilatory sulfite reductase (de	3e-04
pfam00037		24	pfam00037, Fer4, 4Fe-4S binding domain	3e-04
COG0437		203	COG0437, HybA, Fe-S-cluster-containing hydrogenase	4e-04
COG1148		622	COG1148, HdrA, Heterodisulfide reductase, subunit	4e-04
TIGR04105		462	TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, gro	4e-04
PRK05035		695	PRK05035, PRK05035, electron transport complex pro	4e-04
PRK02651		81	PRK02651, PRK02651, photosystem I subunit VII; Pro	4e-04
COG1142		165	COG1142, HycB, Fe-S-cluster-containing hydrogenase	4e-04
TIGR03336		595	TIGR03336, IOR_alpha, indolepyruvate ferredoxin ox	6e-04
PRK14028		312	PRK14028, PRK14028, pyruvate ferredoxin oxidoreduc	6e-04
TIGR02163		255	TIGR02163, napH_, ferredoxin-type protein, NapH/Ma	6e-04
TIGR03224		411	TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reduc	8e-04
TIGR02700		234	TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ02	8e-04
TIGR02494		295	TIGR02494, PFLE_PFLC, glycyl-radical enzyme activa	0.001
PRK09625		133	PRK09625, porD, pyruvate flavodoxin oxidoreductase	0.001
PRK13795		636	PRK13795, PRK13795, hypothetical protein; Provisio	0.002
TIGR04105		462	TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, gro	0.002
TIGR04270		535	TIGR04270, Rama_corrin_act, methylamine methyltran	0.002
TIGR03048		80	TIGR03048, PS_I_psaC, photosystem I iron-sulfur pr	0.003
PLN00071		81	PLN00071, PLN00071, photosystem I subunit VII; Pro	0.003
TIGR01582		283	TIGR01582, FDH-beta, formate dehydrogenase, beta s	0.003

>gnl\|CDD\|235424 PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

 Score =  633 bits (1636), Expect = 0.0
 Identities = 204/379 (53%), Positives = 266/379 (70%), Gaps = 19/379 (5%)

Query: 1   MRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISD 60
           MR+GEF +G+ VLR KI+M S NINMRDP++YRIRH +H+RT + WCIYPMYD+AH ISD
Sbjct: 163 MRAGEFPEGSAVLRAKIDMASPNINMRDPVLYRIRHAHHHRTGDKWCIYPMYDFAHCISD 222

Query: 61  AIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLL 120
           AIE ITHS+CTLEF+DHRP Y+W+L+ +        P P+QYEFSRLNLT+T+ SKRKL 
Sbjct: 223 AIEGITHSLCTLEFEDHRPLYDWVLDNL-----PIPPHPRQYEFSRLNLTYTVMSKRKLK 277

Query: 121 KLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDD 180
           +L+E+K VDGWDDPRMPT+ G+RRRGYTPESI+ FC+RIGV+K DS I++ +LE  +R+D
Sbjct: 278 QLVEEKHVDGWDDPRMPTISGLRRRGYTPESIREFCERIGVTKQDSVIDMSMLESCIRED 337

Query: 181 LDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEK-LRYFPISKILWIER 239
           L+  APR MAVL+P+KL+I+N+ + Q  E  AP     H +  E   R  P S+ L+IER
Sbjct: 338 LNENAPRAMAVLDPLKLVITNYPEGQVEELEAP----NHPEDPEMGTREVPFSRELYIER 393

Query: 240 DDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKS 299
           +DFME P KKYFRL P      G  VRLR  YV++C    K+ +  + E++C Y PD+ S
Sbjct: 394 EDFMEEPPKKYFRLVP------GKEVRLRNAYVIKCEEVVKDADGNITEIHCTYDPDTLS 447

Query: 300 GTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVIS 359
           G   +   KVKG IHW+S +HA+  E RLYDRLF  P P     KDF   +NP+S  +  
Sbjct: 448 G-NPADGRKVKGTIHWVSAAHAVPAEVRLYDRLFTVPNPA--AGKDFLDFLNPDSLVIKQ 504

Query: 360 AYLEPNLKLIFPKKHAQFE 378
            ++EP+L    P+   QFE
Sbjct: 505 GFVEPSLADAKPEDRFQFE 523

Length = 554

>gnl\|CDD\|237793 PRK14703, PRK14703, glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional	Back alignment and domain information

>gnl\|CDD\|232977 TIGR00440, glnS, glutaminyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|178450 PLN02859, PLN02859, glutamine-tRNA ligase	Back alignment and domain information

>gnl\|CDD\|235903 PRK06991, PRK06991, ferredoxin; Provisional	Back alignment and domain information

>gnl\|CDD\|240418 PTZ00437, PTZ00437, glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|185676 cd00807, GlnRS_core, catalytic core domain of glutaminyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|235347 PRK05113, PRK05113, electron transport complex protein RnfB; Provisional	Back alignment and domain information

>gnl\|CDD\|225433 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|223087 COG0008, GlnS, Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|233648 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>gnl\|CDD\|216096 pfam00749, tRNA-synt_1c, tRNA synthetases class I (E and Q), catalytic domain	Back alignment and domain information

>gnl\|CDD\|181550 PRK08764, PRK08764, ferredoxin; Provisional	Back alignment and domain information

>gnl\|CDD\|217810 pfam03950, tRNA-synt_1c_C, tRNA synthetases class I (E and Q), anti-codon binding domain	Back alignment and domain information

>gnl\|CDD\|235229 PRK04156, gltX, glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|232985 TIGR00463, gltX_arch, glutamyl-tRNA synthetase, archaeal and eukaryotic family	Back alignment and domain information

>gnl\|CDD\|215492 PLN02907, PLN02907, glutamate-tRNA ligase	Back alignment and domain information

>gnl\|CDD\|240404 PTZ00402, PTZ00402, glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|178772 PLN03233, PLN03233, putative glutamate-tRNA ligase; Provisional	Back alignment and domain information

>gnl\|CDD\|185672 cd00418, GlxRS_core, catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|185682 cd09287, GluRS_non_core, catalytic core domain of non-discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|235941 PRK07118, PRK07118, ferredoxin; Validated	Back alignment and domain information

>gnl\|CDD\|112857 pfam04060, FeS, Putative Fe-S cluster	Back alignment and domain information

>gnl\|CDD\|224068 COG1145, NapF, Ferredoxin [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|224069 COG1146, COG1146, Ferredoxin [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|235637 PRK05888, PRK05888, NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>gnl\|CDD\|221966 pfam13187, Fer4_9, 4Fe-4S dicluster domain	Back alignment and domain information

>gnl\|CDD\|235941 PRK07118, PRK07118, ferredoxin; Validated	Back alignment and domain information

>gnl\|CDD\|224067 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|131234 TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>gnl\|CDD\|221801 pfam12838, Fer4_7, 4Fe-4S dicluster domain	Back alignment and domain information

>gnl\|CDD\|205417 pfam13237, Fer4_10, 4Fe-4S dicluster domain	Back alignment and domain information

>gnl\|CDD\|233661 TIGR01971, NuoI, NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>gnl\|CDD\|236237 PRK08318, PRK08318, dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>gnl\|CDD\|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|237510 PRK13795, PRK13795, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233903 TIGR02512, FeFe_hydrog_A, [FeFe] hydrogenase, group A	Back alignment and domain information

>gnl\|CDD\|224066 COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|170016 PRK09623, vorD, 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>gnl\|CDD\|221963 pfam13183, Fer4_8, 4Fe-4S dicluster domain	Back alignment and domain information

>gnl\|CDD\|188556 TIGR04041, activase_YjjW, glycine radical enzyme activase, YjjW family	Back alignment and domain information

>gnl\|CDD\|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|182135 PRK09898, PRK09898, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|129498 TIGR00403, ndhI, NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>gnl\|CDD\|224373 COG1456, CdhE, CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional	Back alignment and domain information

>gnl\|CDD\|222168 pfam13484, Fer4_16, 4Fe-4S double cluster binding domain	Back alignment and domain information

>gnl\|CDD\|181399 PRK08348, PRK08348, NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|214334 CHL00014, ndhI, NADH dehydrogenase subunit I	Back alignment and domain information

>gnl\|CDD\|226684 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|235235 PRK04165, PRK04165, acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional	Back alignment and domain information

>gnl\|CDD\|170017 PRK09624, porD, pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>gnl\|CDD\|225131 COG2221, DsrA, Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|215671 pfam00037, Fer4, 4Fe-4S binding domain	Back alignment and domain information

>gnl\|CDD\|223514 COG0437, HybA, Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|234472 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, group B1/B3	Back alignment and domain information

>gnl\|CDD\|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional	Back alignment and domain information

>gnl\|CDD\|179457 PRK02651, PRK02651, photosystem I subunit VII; Provisional	Back alignment and domain information

>gnl\|CDD\|224065 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|234170 TIGR03336, IOR_alpha, indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>gnl\|CDD\|172522 PRK14028, PRK14028, pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>gnl\|CDD\|233754 TIGR02163, napH_, ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>gnl\|CDD\|132268 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, BoxA protein	Back alignment and domain information

>gnl\|CDD\|131747 TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>gnl\|CDD\|233895 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating protein family	Back alignment and domain information

>gnl\|CDD\|236596 PRK09625, porD, pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>gnl\|CDD\|237510 PRK13795, PRK13795, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|234472 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, group B1/B3	Back alignment and domain information

>gnl\|CDD\|211993 TIGR04270, Rama_corrin_act, methylamine methyltransferase corrinoid protein reductive activase	Back alignment and domain information

>gnl\|CDD\|132092 TIGR03048, PS_I_psaC, photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>gnl\|CDD\|177700 PLN00071, PLN00071, photosystem I subunit VII; Provisional	Back alignment and domain information

>gnl\|CDD\|233481 TIGR01582, FDH-beta, formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		582
PRK05347		554	glutaminyl-tRNA synthetase; Provisional	100.0
PTZ00437		574	glutaminyl-tRNA synthetase; Provisional	100.0
PRK14703		771	glutaminyl-tRNA synthetase/YqeY domain fusion prot	100.0
PLN02859		788	glutamine-tRNA ligase	100.0
KOG1148\|consensus		764		100.0
TIGR00440		522	glnS glutaminyl-tRNA synthetase. This protein is a	100.0
PLN03233		523	putative glutamate-tRNA ligase; Provisional	100.0
PTZ00402		601	glutamyl-tRNA synthetase; Provisional	100.0
PLN02907		722	glutamate-tRNA ligase	100.0
KOG1147\|consensus		712		100.0
PRK04156		567	gltX glutamyl-tRNA synthetase; Provisional	100.0
TIGR00463		560	gltX_arch glutamyl-tRNA synthetase, archaeal and e	100.0
COG0008		472	GlnS Glutamyl- and glutaminyl-tRNA synthetases [Tr	100.0
cd00807		238	GlnRS_core catalytic core domain of glutaminyl-tRN	100.0
cd09287		240	GluRS_non_core catalytic core domain of non-discri	100.0
PF03950		174	tRNA-synt_1c_C: tRNA synthetases class I (E and Q)	100.0
PRK12410		433	glutamylglutaminyl-tRNA synthetase; Provisional	100.0
PRK12558		445	glutamyl-tRNA synthetase; Provisional	99.98
PF00749		314	tRNA-synt_1c: tRNA synthetases class I (E and Q),	99.97
PLN02627		535	glutamyl-tRNA synthetase	99.97
KOG1149\|consensus		524		99.96
PRK06991		270	ferredoxin; Provisional	99.96
cd00418		230	GlxRS_core catalytic core domain of glutamyl-tRNA	99.96
PRK14895		513	gltX glutamyl-tRNA synthetase; Provisional	99.95
PRK01406		476	gltX glutamyl-tRNA synthetase; Reviewed	99.95
TIGR03838		272	queuosine_YadB glutamyl-queuosine tRNA(Asp) synthe	99.94
TIGR00464		470	gltX_bact glutamyl-tRNA synthetase, bacterial fami	99.94
PRK05710		299	glutamyl-Q tRNA(Asp) synthetase; Reviewed	99.94
cd00808		239	GluRS_core catalytic core domain of discriminating	99.92
COG2878		198	Predicted NADH:ubiquinone oxidoreductase, subunit	99.84
PRK08764		135	ferredoxin; Provisional	99.84
PRK05113		191	electron transport complex protein RnfB; Provision	99.8
TIGR01944		165	rnfB electron transport complex, RnfABCDGE type, B	99.76
PRK07118		280	ferredoxin; Validated	99.58
PRK08493		819	NADH dehydrogenase subunit G; Validated	99.34
COG3383		978	Uncharacterized anaerobic dehydrogenase [General f	99.3
COG0437		203	HybA Fe-S-cluster-containing hydrogenase component	99.3
PF13247		98	Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX	99.29
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	99.29
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	99.28
PTZ00305		297	NADH:ubiquinone oxidoreductase; Provisional	99.26
PRK07569		234	bidirectional hydrogenase complex protein HoxU; Va	99.26
TIGR01973		603	NuoG NADH-quinone oxidoreductase, chain G. This mo	99.21
TIGR01660		492	narH nitrate reductase, beta subunit. The Nitrate	99.21
PRK09130		687	NADH dehydrogenase subunit G; Validated	99.19
PRK05035		695	electron transport complex protein RnfC; Provision	99.17
PRK09129		776	NADH dehydrogenase subunit G; Validated	99.16
PRK07860		797	NADH dehydrogenase subunit G; Validated	99.14
PRK08166		847	NADH dehydrogenase subunit G; Validated	99.13
TIGR03478		321	DMSO_red_II_bet DMSO reductase family type II enzy	99.1
COG1034		693	NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc	99.07
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	99.06
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	99.04
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	99.03
COG1144		91	Pyruvate:ferredoxin oxidoreductase and related 2-o	99.03
PRK09898		208	hypothetical protein; Provisional	99.02
PRK14993		244	tetrathionate reductase subunit B; Provisional	99.01
PRK10882		328	hydrogenase 2 protein HybA; Provisional	98.97
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	98.97
COG1142		165	HycB Fe-S-cluster-containing hydrogenase component	98.97
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	98.95
TIGR01582		283	FDH-beta formate dehydrogenase, beta subunit, Fe-S	98.95
PRK08222		181	hydrogenase 4 subunit H; Validated	98.94
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	98.93
TIGR02179		78	PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta	98.92
PRK09623		105	vorD 2-ketoisovalerate ferredoxin oxidoreductase s	98.9
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	98.9
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	98.9
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	98.88
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	98.87
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	98.86
KOG3256\|consensus		212		98.86
COG1146		68	Ferredoxin [Energy production and conversion]	98.84
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	98.84
TIGR02951		161	DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi	98.82
CHL00065		81	psaC photosystem I subunit VII	98.81
PRK05888		164	NADH dehydrogenase subunit I; Provisional	98.81
PLN00071		81	photosystem I subunit VII; Provisional	98.79
PF13237		52	Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A.	98.79
COG1145		99	NapF Ferredoxin [Energy production and conversion]	98.78
PRK06273		165	ferredoxin; Provisional	98.77
CHL00014		167	ndhI NADH dehydrogenase subunit I	98.77
COG1149		284	MinD superfamily P-loop ATPase containing an inser	98.76
TIGR02060		132	aprB adenosine phosphosulphate reductase, beta sub	98.75
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	98.73
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	98.71
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	98.68
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	98.67
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	98.63
PRK10194		163	ferredoxin-type protein; Provisional	98.6
PRK09477		271	napH quinol dehydrogenase membrane component; Prov	98.6
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	98.59
PRK02651		81	photosystem I subunit VII; Provisional	98.59
TIGR02163		255	napH_ ferredoxin-type protein, NapH/MauN family. M	98.59
PRK09476		254	napG quinol dehydrogenase periplasmic component; P	98.58
PF13247		98	Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX	98.56
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	98.54
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	98.54
COG4656		529	RnfC Predicted NADH:ubiquinone oxidoreductase, sub	98.52
TIGR01660		492	narH nitrate reductase, beta subunit. The Nitrate	98.49
PRK14028		312	pyruvate ferredoxin oxidoreductase subunit gamma/d	98.49
TIGR02700		234	flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T	98.47
COG1142		165	HycB Fe-S-cluster-containing hydrogenase component	98.45
COG1140		513	NarY Nitrate reductase beta subunit [Energy produc	98.42
TIGR02512		374	Fe_only_hydrog hydrogenases, Fe-only. This model d	98.4
TIGR03478		321	DMSO_red_II_bet DMSO reductase family type II enzy	98.39
PRK10194		163	ferredoxin-type protein; Provisional	98.37
COG2768		354	Uncharacterized Fe-S center protein [General funct	98.37
TIGR02912		314	sulfite_red_C sulfite reductase, subunit C. Member	98.35
TIGR03224		411	benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p	98.34
cd00671		212	ArgRS_core catalytic core domain of arginyl-tRNA s	98.34
TIGR03287		391	methan_mark_16 putative methanogenesis marker 16 m	98.34
COG2221		317	DsrA Dissimilatory sulfite reductase (desulfovirid	98.33
PRK07118		280	ferredoxin; Validated	98.3
PRK00783		263	DNA-directed RNA polymerase subunit D; Provisional	98.29
cd07030		259	RNAP_D D subunit of Archaeal RNA polymerase. The D	98.28
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	98.27
TIGR01582		283	FDH-beta formate dehydrogenase, beta subunit, Fe-S	98.25
TIGR03294		228	FrhG coenzyme F420 hydrogenase, subunit gamma. Thi	98.25
PRK13984		604	putative oxidoreductase; Provisional	98.24
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	98.24
PRK14993		244	tetrathionate reductase subunit B; Provisional	98.23
PF12837		24	Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450	98.2
COG0437		203	HybA Fe-S-cluster-containing hydrogenase component	98.19
PRK09898		208	hypothetical protein; Provisional	98.13
PRK15449		95	ferredoxin-like protein FixX; Provisional	98.12
PF13484		67	Fer4_16: 4Fe-4S double cluster binding domain	98.11
PRK13795		636	hypothetical protein; Provisional	98.1
TIGR02951		161	DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi	98.09
PRK10882		328	hydrogenase 2 protein HybA; Provisional	98.07
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	98.07
PRK09326		341	F420H2 dehydrogenase subunit F; Provisional	98.05
PRK09476		254	napG quinol dehydrogenase periplasmic component; P	98.0
PF00037		24	Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T	97.97
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	97.96
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	97.94
TIGR02745		434	ccoG_rdxA_fixG cytochrome c oxidase accessory prot	97.91
COG4231		640	Indolepyruvate ferredoxin oxidoreductase, alpha an	97.86
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	97.84
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	97.81
TIGR02066		341	dsrB sulfite reductase, dissimilatory-type beta su	97.8
PF00037		24	Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T	97.79
PF04060		35	FeS: Putative Fe-S cluster; InterPro: IPR007202 Th	97.78
PF12837		24	Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450	97.78
TIGR03336		595	IOR_alpha indolepyruvate ferredoxin oxidoreductase	97.75
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	97.7
cd00802		143	class_I_aaRS_core catalytic core domain of class I	97.68
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	97.65
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	97.6
PF13183		57	Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_	97.59
PRK13409		590	putative ATPase RIL; Provisional	97.58
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	97.54
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	97.51
TIGR01945		435	rnfC electron transport complex, RnfABCDGE type, C	97.46
PF12797		22	Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450	97.44
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	97.38
PRK00941		781	acetyl-CoA decarbonylase/synthase complex subunit	97.25
COG2440		99	FixX Ferredoxin-like protein [Energy production an	97.19
TIGR00276		282	iron-sulfur cluster binding protein, putative. Thi	97.18
PRK07570		250	succinate dehydrogenase/fumarate reductase iron-su	97.17
PRK13984		604	putative oxidoreductase; Provisional	97.16
PF12798		15	Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450	97.14
PF13534		61	Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9	97.13
TIGR00314		784	cdhA CO dehydrogenase/acetyl-CoA synthase complex,	97.11
cd01916		731	ACS_1 Acetyl-CoA synthase (ACS), also known as ace	97.09
TIGR03290		144	CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s	97.08
COG1141		68	Fer Ferredoxin [Energy production and conversion]	97.07
TIGR02064		402	dsrA sulfite reductase, dissimilatory-type alpha s	97.06
PF13459		65	Fer4_15: 4Fe-4S single cluster domain	97.06
TIGR00384		220	dhsB succinate dehydrogenase and fumarate reductas	97.04
PF13370		58	Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A	97.04
PRK12814		652	putative NADPH-dependent glutamate synthase small	97.04
KOG2282\|consensus		708		96.96
PRK00750		510	lysK lysyl-tRNA synthetase; Reviewed	96.88
TIGR02486		314	RDH reductive dehalogenase. This model represents	96.86
PRK06214		530	sulfite reductase; Provisional	96.85
PRK04165		450	acetyl-CoA decarbonylase/synthase complex subunit	96.81
PRK08222		181	hydrogenase 4 subunit H; Validated	96.8
PF12798		15	Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450	96.8
PRK12576		279	succinate dehydrogenase iron-sulfur subunit; Provi	96.77
PRK13030		1159	2-oxoacid ferredoxin oxidoreductase; Provisional	96.76
TIGR01936		447	nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo	96.74
TIGR00273		432	iron-sulfur cluster-binding protein. Members of th	96.74
COG1139		459	Uncharacterized conserved protein containing a fer	96.68
PRK05352		448	Na(+)-translocating NADH-quinone reductase subunit	96.65
PRK09193		1165	indolepyruvate ferredoxin oxidoreductase; Validate	96.6
PRK12385		244	fumarate reductase iron-sulfur subunit; Provisiona	96.55
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	96.52
PRK13029		1186	2-oxoacid ferredoxin oxidoreductase; Provisional	96.52
COG1144		91	Pyruvate:ferredoxin oxidoreductase and related 2-o	96.49
PF12797		22	Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450	96.47
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	96.43
PF12800		17	Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450	96.42
PRK11168		396	glpC sn-glycerol-3-phosphate dehydrogenase subunit	96.42
COG1600		337	Uncharacterized Fe-S protein [Energy production an	96.31
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	96.28
PRK08640		249	sdhB succinate dehydrogenase iron-sulfur subunit;	96.21
TIGR03379		397	glycerol3P_GlpC glycerol-3-phosphate dehydrogenase	96.18
TIGR02060		132	aprB adenosine phosphosulphate reductase, beta sub	96.15
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	96.14
PRK05950		232	sdhB succinate dehydrogenase iron-sulfur subunit;	96.12
TIGR02910		334	sulfite_red_A sulfite reductase, subunit A. Member	96.06
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	96.05
PRK01611		507	argS arginyl-tRNA synthetase; Reviewed	95.96
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	95.91
PRK12386		251	fumarate reductase iron-sulfur subunit; Provisiona	95.87
PF10588		41	NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G	95.87
PRK15055		344	anaerobic sulfite reductase subunit A; Provisional	95.87
PRK12577		329	succinate dehydrogenase iron-sulfur subunit; Provi	95.86
PRK05888		164	NADH dehydrogenase subunit I; Provisional	95.83
KOG0063\|consensus		592		95.83
PF13237		52	Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A.	95.8
PRK09623		105	vorD 2-ketoisovalerate ferredoxin oxidoreductase s	95.8
PRK13552		239	frdB fumarate reductase iron-sulfur subunit; Provi	95.78
PRK05113		191	electron transport complex protein RnfB; Provision	95.75
PRK06273		165	ferredoxin; Provisional	95.73
COG1035		332	FrhB Coenzyme F420-reducing hydrogenase, beta subu	95.72
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	95.71
TIGR02179		78	PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta	95.69
PRK15449		95	ferredoxin-like protein FixX; Provisional	95.68
TIGR02163		255	napH_ ferredoxin-type protein, NapH/MauN family. M	95.64
PRK06991		270	ferredoxin; Provisional	95.59
TIGR01944		165	rnfB electron transport complex, RnfABCDGE type, B	95.57
PRK12575		235	succinate dehydrogenase iron-sulfur subunit; Provi	95.57
PF12800		17	Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450	95.55
COG1152		772	CdhA CO dehydrogenase/acetyl-CoA synthase alpha su	95.53
CHL00014		167	ndhI NADH dehydrogenase subunit I	95.46
PRK05035		695	electron transport complex protein RnfC; Provision	95.41
PRK11274		407	glcF glycolate oxidase iron-sulfur subunit; Provis	95.39
PRK13409		590	putative ATPase RIL; Provisional	95.36
COG0479		234	FrdB Succinate dehydrogenase/fumarate reductase, F	95.36
PRK06259		486	succinate dehydrogenase/fumarate reductase iron-su	95.3
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	95.3
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	95.27
TIGR03224		411	benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p	95.26
TIGR02066		341	dsrB sulfite reductase, dissimilatory-type beta su	95.25
PRK02651		81	photosystem I subunit VII; Provisional	95.25
PRK14028		312	pyruvate ferredoxin oxidoreductase subunit gamma/d	95.22
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	95.2
PLN00129		276	succinate dehydrogenase [ubiquinone] iron-sulfur s	95.15
KOG0063\|consensus		592		95.12
TIGR02484		372	CitB CitB domain protein. CobZ is essential for co	95.1
PRK08764		135	ferredoxin; Provisional	95.08
PRK09477		271	napH quinol dehydrogenase membrane component; Prov	95.07
KOG3256\|consensus		212		95.02
TIGR03287		391	methan_mark_16 putative methanogenesis marker 16 m	95.0
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	94.97
COG1146		68	Ferredoxin [Energy production and conversion]	94.95
COG0348		386	NapH Polyferredoxin [Energy production and convers	94.91
COG0247		388	GlpC Fe-S oxidoreductase [Energy production and co	94.89
TIGR02745		434	ccoG_rdxA_fixG cytochrome c oxidase accessory prot	94.87
COG1150		195	HdrC Heterodisulfide reductase, subunit C [Energy	94.87
cd00674		353	LysRS_core_class_I catalytic core domain of class	94.84
PF13484		67	Fer4_16: 4Fe-4S double cluster binding domain	94.77
PRK15033		389	tricarballylate utilization protein B; Provisional	94.74
TIGR02912		314	sulfite_red_C sulfite reductase, subunit C. Member	94.5
COG1145		99	NapF Ferredoxin [Energy production and conversion]	94.47
COG1453		391	Predicted oxidoreductases of the aldo/keto reducta	94.42
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	94.34
COG4231		640	Indolepyruvate ferredoxin oxidoreductase, alpha an	94.34
PRK12418		384	cysteinyl-tRNA synthetase; Provisional	94.18
COG2768		354	Uncharacterized Fe-S center protein [General funct	94.11
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	94.06
COG2221		317	DsrA Dissimilatory sulfite reductase (desulfovirid	93.99
COG1149		284	MinD superfamily P-loop ATPase containing an inser	93.99
TIGR02700		234	flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T	93.89
COG1140		513	NarY Nitrate reductase beta subunit [Energy produc	93.87
PF13746		69	Fer4_18: 4Fe-4S dicluster domain	93.66
TIGR03447		411	mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-	93.55
PLN00071		81	photosystem I subunit VII; Provisional	93.55
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	93.53
PRK14534		481	cysS cysteinyl-tRNA synthetase; Provisional	93.51
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	93.49
TIGR00435		465	cysS cysteinyl-tRNA synthetase. This model finds t	93.49
CHL00065		81	psaC photosystem I subunit VII	93.37
COG1941		247	FrhG Coenzyme F420-reducing hydrogenase, gamma sub	93.37
PF13746		69	Fer4_18: 4Fe-4S dicluster domain	93.31
PF09334		391	tRNA-synt_1g: tRNA synthetases class I (M); InterP	93.3
PRK13795		636	hypothetical protein; Provisional	93.22
TIGR02512		374	Fe_only_hydrog hydrogenases, Fe-only. This model d	93.22
cd07030		259	RNAP_D D subunit of Archaeal RNA polymerase. The D	93.2
PRK11893		511	methionyl-tRNA synthetase; Reviewed	93.15
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	93.08
COG2878		198	Predicted NADH:ubiquinone oxidoreductase, subunit	92.96
PRK00783		263	DNA-directed RNA polymerase subunit D; Provisional	92.79
PRK00260		463	cysS cysteinyl-tRNA synthetase; Validated	92.78
PRK14494		229	putative molybdopterin-guanine dinucleotide biosyn	92.73
PRK14536		490	cysS cysteinyl-tRNA synthetase; Provisional	92.72
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	92.7
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	92.23
PLN02946		557	cysteine-tRNA ligase	91.93
COG3383		978	Uncharacterized anaerobic dehydrogenase [General f	91.85
TIGR03336		595	IOR_alpha indolepyruvate ferredoxin oxidoreductase	90.87
PLN02610		801	probable methionyl-tRNA synthetase	90.69
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	90.56
PRK08493		819	NADH dehydrogenase subunit G; Validated	90.49
PRK12451		562	arginyl-tRNA synthetase; Reviewed	90.14
TIGR00398		530	metG methionyl-tRNA synthetase. The methionyl-tRNA	90.01
COG1456		467	CdhE CO dehydrogenase/acetyl-CoA synthase gamma su	89.85
TIGR00467		515	lysS_arch lysyl-tRNA synthetase, archaeal and spir	89.48
PF01406		300	tRNA-synt_1e: tRNA synthetases class I (C) catalyt	89.02
PRK09326		341	F420H2 dehydrogenase subunit F; Provisional	88.87
PTZ00399		651	cysteinyl-tRNA-synthetase; Provisional	88.46
TIGR00456		566	argS arginyl-tRNA synthetase. This model recognize	88.01
TIGR00395		938	leuS_arch leucyl-tRNA synthetase, archaeal and cyt	87.91
COG0215		464	CysS Cysteinyl-tRNA synthetase [Translation, ribos	87.2
COG4871		193	Uncharacterized protein conserved in archaea [Func	87.2
PRK00133		673	metG methionyl-tRNA synthetase; Reviewed	87.05
PF06902		64	Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro:	86.75
PRK07569		234	bidirectional hydrogenase complex protein HoxU; Va	86.57
PRK12267		648	methionyl-tRNA synthetase; Reviewed	86.34
PRK12268		556	methionyl-tRNA synthetase; Reviewed	85.8
TIGR00384		220	dhsB succinate dehydrogenase and fumarate reductas	85.5
PRK14535		699	cysS cysteinyl-tRNA synthetase; Provisional	85.49
TIGR03294		228	FrhG coenzyme F420 hydrogenase, subunit gamma. Thi	85.09
TIGR01945		435	rnfC electron transport complex, RnfABCDGE type, C	85.08
PLN02286		576	arginine-tRNA ligase	84.88
COG1453		391	Predicted oxidoreductases of the aldo/keto reducta	84.66
TIGR00314		784	cdhA CO dehydrogenase/acetyl-CoA synthase complex,	84.44
TIGR03290		144	CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s	84.3
PF13459		65	Fer4_15: 4Fe-4S single cluster domain	84.14
TIGR02486		314	RDH reductive dehalogenase. This model represents	83.77
PLN02224		616	methionine-tRNA ligase	83.77
cd02156		105	nt_trans nucleotidyl transferase superfamily. nt_t	83.47
COG2000		226	Predicted Fe-S protein [General function predictio	83.03
COG1152		772	CdhA CO dehydrogenase/acetyl-CoA synthase alpha su	82.91
cd01916		731	ACS_1 Acetyl-CoA synthase (ACS), also known as ace	81.79
TIGR00276		282	iron-sulfur cluster binding protein, putative. Thi	81.7
PF13370		58	Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A	81.5
PRK00941		781	acetyl-CoA decarbonylase/synthase complex subunit	80.79
PF13183		57	Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_	80.53
cd00812		314	LeuRS_core catalytic core domain of leucyl-tRNA sy	80.39
TIGR01973		603	NuoG NADH-quinone oxidoreductase, chain G. This mo	80.22
cd00668		312	Ile_Leu_Val_MetRS_core catalytic core domain of is	80.16

>PRK05347 glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

Probab=100.00  E-value=2.8e-104  Score=854.63  Aligned_cols=363  Identities=56%  Similarity=0.995  Sum_probs=348.7

Q ss_pred             CCCCCCCCCceEEEEEEeccCCCCCCCCcEEEEecCCCccccCCeeeeecccccccccccccCCCcEEecCcccccChHH
Q psy9414           1 MRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPF   80 (582)
Q Consensus         1 M~~g~~~~g~~~~r~k~d~~~~n~~~~D~v~~R~~~~~H~~~g~k~~~~P~Y~fa~~vdD~~~githvir~~e~~~~~~~   80 (582)
                      |++|+|++|++|||+|+||.++|++|||||+||++.++|||||+||+||||||||||||||+|||||||||+||++||++
T Consensus       163 m~~G~~~~g~~vlR~Kid~~~~n~~~rD~Vi~R~~~~~H~r~G~k~~iyPtYdfA~~vdD~l~gITHvlRg~E~~~~t~~  242 (554)
T PRK05347        163 MRAGEFPEGSAVLRAKIDMASPNINMRDPVLYRIRHAHHHRTGDKWCIYPMYDFAHCISDAIEGITHSLCTLEFEDHRPL  242 (554)
T ss_pred             HHCCCCCCCcEEEEEEeeccCCCCCCCCCEEEEecCCCCCccCCceeeecCcCccceeeccccCCceEEeccccccChHH
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCCCCCCCCCceeEeecccCCCccccccchhhhccccccCCCCCCCcccHHHHHHcCCCHHHHHHHHHHhc
Q psy9414          81 YEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIG  160 (582)
Q Consensus        81 ~~~l~~~l~~~~~~~~~~p~~~~~~~l~~~~~~lSKr~~~~~v~~~~v~gwdDpr~~tl~~lr~~G~~p~ai~~~~~~~G  160 (582)
                      |.|||++|||     ...|.+++|+|||++|++||||++.+||++|.|+|||||||+||+|||||||+|+||++|+..+|
T Consensus       243 ~~~i~~alg~-----~~~P~~~~F~rln~~~~~LSKRkl~~lV~~g~v~GWDDPRl~Ti~~lrrrG~~PeAi~nf~~~lG  317 (554)
T PRK05347        243 YDWVLDNLPI-----PPHPRQYEFSRLNLTYTVMSKRKLKQLVEEKHVDGWDDPRMPTISGLRRRGYTPESIREFCERIG  317 (554)
T ss_pred             HHHHHHHcCC-----CCCCceEEEEEECCCCCccccccchhccccCcccCccCCcchhHHHHHHCCCCHHHHHHHHHHhC
Confidence            9999999996     15899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCcccHHHHHHHHHHhhhccCCceeeeecceEEEEEccCCCceEEEEccCCcCCCCcc-CCCceEEeecceEEEec
Q psy9414         161 VSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQY-KEKLRYFPISKILWIER  239 (582)
Q Consensus       161 ~s~~~~~~~~~~l~~~~~~~l~~~~~r~~~v~~p~~~~i~n~~~~~~~~~~~p~~~~~hp~~-~~G~r~i~~~~~i~i~~  239 (582)
                      +|++++.|+|++||++||++||+.|+|+|||++|++|+|+|++++..+.+++|+    ||++ ++|+|++.|+++||||+
T Consensus       318 ~s~~~~~i~~~~L~~~nRk~ld~~a~R~m~V~~pv~v~i~n~~~~~~~~~~~p~----hP~~~~~G~r~i~~~~~iyIe~  393 (554)
T PRK05347        318 VTKQDSVIDMSMLESCIREDLNENAPRAMAVLDPLKLVITNYPEGQVEELEAPN----HPEDPEMGTREVPFSRELYIER  393 (554)
T ss_pred             CCCCCCeecHHHHHHHHHHHhccCCCceEEEcCCeEEEEEeCCCCceEEEEecC----CCCCCcCceEEEEEcCeEEEEh
Confidence            999999999999999999999999999999999999999999877777899999    9999 99999999999999999


Q ss_pred             CcccccccccccccCCCCCCCCCceEEEeecEEEEEeeEEecCCCCEEEEEEEEeCCCCCCCCCCCCCCcceEEEeecCC
Q psy9414         240 DDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKS  319 (582)
Q Consensus       240 ~D~~~~~~~~f~~l~~~~~~~~g~~v~L~~~~~i~~~~~~~d~~g~v~~~~~~~~~~~~~~~~~~~~~k~k~~I~Wv~~~  319 (582)
                      +||++.++++|+||++      |++||||++++|+|+++.+|++|.|++++|+|+++++++. .+.++|+|++|||||+.
T Consensus       394 ~D~~~~~~~~~~rl~~------g~~vrL~~~~~i~~~~~~kd~~g~v~~~~~~~~~~~~~g~-~~~~kk~k~~IhWv~~~  466 (554)
T PRK05347        394 EDFMEEPPKKYFRLVP------GKEVRLRNAYVIKCEEVVKDADGNITEIHCTYDPDTLSGN-PADGRKVKGTIHWVSAA  466 (554)
T ss_pred             HHhhccccccccccCC------CCEEEecCEEEEEEEEEEEcCCCCEEEEEEEEccccccCC-CccCcccCCEEEeeecC
Confidence            9999999999999999      9999999999999999999999999999999999887653 23446888999999988


Q ss_pred             CCeeeEEEeccccccCCCCCccCCCcccccccCCceEEEEEEEccccccccccccccccccc
Q psy9414         320 HALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNL  381 (582)
Q Consensus       320 ~~i~~~vr~Yd~L~~~~~p~~~~~~d~~~~iNp~Sl~v~~~~vep~l~~~~~~d~~QfeR~g  381 (582)
                      ++++++|++||+||++++|+.  +++|+++|||+|+.+..+++||++..+..++.+||||.|
T Consensus       467 ~~v~~~v~~yd~Lf~~~~p~~--~~~~~~~iN~~s~~~~~~~~E~~~~~~~~~~~~QfeR~G  526 (554)
T PRK05347        467 HAVPAEVRLYDRLFTVPNPAA--GKDFLDFLNPDSLVIKQGFVEPSLADAKPEDRFQFEREG  526 (554)
T ss_pred             CCEeEEEEEeccccCCCCCCc--cccHhHhcCCCceEEEeEEEcHHHhhCCCCCEEEEEEee
Confidence            899999999999999999986  589999999999988899999999999999999999994

>PTZ00437 glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK14703 glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional	Back alignment and domain information

>PLN02859 glutamine-tRNA ligase	Back alignment and domain information

>KOG1148\|consensus	Back alignment and domain information

>TIGR00440 glnS glutaminyl-tRNA synthetase	Back alignment and domain information

>PLN03233 putative glutamate-tRNA ligase; Provisional	Back alignment and domain information

>PTZ00402 glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>PLN02907 glutamate-tRNA ligase	Back alignment and domain information

>KOG1147\|consensus	Back alignment and domain information

>PRK04156 gltX glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR00463 gltX_arch glutamyl-tRNA synthetase, archaeal and eukaryotic family	Back alignment and domain information

>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd00807 GlnRS_core catalytic core domain of glutaminyl-tRNA synthetase	Back alignment and domain information

>cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>PF03950 tRNA-synt_1c_C: tRNA synthetases class I (E and Q), anti-codon binding domain; InterPro: IPR020059 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PRK12410 glutamylglutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK12558 glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>PF00749 tRNA-synt_1c: tRNA synthetases class I (E and Q), catalytic domain; InterPro: IPR020058 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PLN02627 glutamyl-tRNA synthetase	Back alignment and domain information

>KOG1149\|consensus	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase	Back alignment and domain information

>PRK14895 gltX glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed	Back alignment and domain information

>TIGR03838 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthetase	Back alignment and domain information

>TIGR00464 gltX_bact glutamyl-tRNA synthetase, bacterial family	Back alignment and domain information

>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed	Back alignment and domain information

>cd00808 GluRS_core catalytic core domain of discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>PRK05113 electron transport complex protein RnfB; Provisional	Back alignment and domain information

>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>PRK08493 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional	Back alignment and domain information

>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>TIGR01660 narH nitrate reductase, beta subunit	Back alignment and domain information

>PRK09130 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK05035 electron transport complex protein RnfC; Provisional	Back alignment and domain information

>PRK09129 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK07860 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK08166 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit	Back alignment and domain information

>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>PRK09898 hypothetical protein; Provisional	Back alignment and domain information

>PRK14993 tetrathionate reductase subunit B; Provisional	Back alignment and domain information

>PRK10882 hydrogenase 2 protein HybA; Provisional	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>KOG3256\|consensus	Back alignment and domain information

>COG1146 Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit	Back alignment and domain information

>CHL00065 psaC photosystem I subunit VII	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>PRK09477 napH quinol dehydrogenase membrane component; Provisional	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional	Back alignment and domain information

>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion]	Back alignment and domain information

>TIGR01660 narH nitrate reductase, beta subunit	Back alignment and domain information

>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion]	Back alignment and domain information

>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only	Back alignment and domain information

>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>COG2768 Uncharacterized Fe-S center protein [General function prediction only]	Back alignment and domain information

>TIGR02912 sulfite_red_C sulfite reductase, subunit C	Back alignment and domain information

>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein	Back alignment and domain information

>cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases	Back alignment and domain information

>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein	Back alignment and domain information

>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>PRK00783 DNA-directed RNA polymerase subunit D; Provisional	Back alignment and domain information

>cd07030 RNAP_D D subunit of Archaeal RNA polymerase	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>PRK14993 tetrathionate reductase subunit B; Provisional	Back alignment and domain information

>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>PRK09898 hypothetical protein; Provisional	Back alignment and domain information

>PRK15449 ferredoxin-like protein FixX; Provisional	Back alignment and domain information

>PF13484 Fer4_16: 4Fe-4S double cluster binding domain	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit	Back alignment and domain information

>PRK10882 hydrogenase 2 protein HybA; Provisional	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>PRK09326 F420H2 dehydrogenase subunit F; Provisional	Back alignment and domain information

>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional	Back alignment and domain information

>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG	Back alignment and domain information

>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit	Back alignment and domain information

>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PF04060 FeS: Putative Fe-S cluster; InterPro: IPR007202 These proteins contain a domain with four conserved cysteines that probably form an Fe-S redox cluster	Back alignment and domain information

>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit	Back alignment and domain information

>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated	Back alignment and domain information

>COG2440 FixX Ferredoxin-like protein [Energy production and conversion]	Back alignment and domain information

>TIGR00276 iron-sulfur cluster binding protein, putative	Back alignment and domain information

>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B	Back alignment and domain information

>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit	Back alignment and domain information

>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA	Back alignment and domain information

>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C	Back alignment and domain information

>COG1141 Fer Ferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit	Back alignment and domain information

>PF13459 Fer4_15: 4Fe-4S single cluster domain	Back alignment and domain information

>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein	Back alignment and domain information

>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>KOG2282\|consensus	Back alignment and domain information

>PRK00750 lysK lysyl-tRNA synthetase; Reviewed	Back alignment and domain information

>TIGR02486 RDH reductive dehalogenase	Back alignment and domain information

>PRK06214 sulfite reductase; Provisional	Back alignment and domain information

>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit	Back alignment and domain information

>TIGR00273 iron-sulfur cluster-binding protein	Back alignment and domain information

>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion]	Back alignment and domain information

>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional	Back alignment and domain information

>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated	Back alignment and domain information

>PRK12385 fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional	Back alignment and domain information

>COG1600 Uncharacterized Fe-S protein [Energy production and conversion]	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed	Back alignment and domain information

>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit	Back alignment and domain information

>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed	Back alignment and domain information

>TIGR02910 sulfite_red_A sulfite reductase, subunit A	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>PRK01611 argS arginyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK12386 fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>PF10588 NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G iron-sulfur binding region; InterPro: IPR019574 NADH:ubiquinone oxidoreductase (complex I) (1	Back alignment and domain information

>PRK15055 anaerobic sulfite reductase subunit A; Provisional	Back alignment and domain information

>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A	Back alignment and domain information

>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK05113 electron transport complex protein RnfB; Provisional	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion]	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>PRK15449 ferredoxin-like protein FixX; Provisional	Back alignment and domain information

>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion]	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>PRK05035 electron transport complex protein RnfC; Provisional	Back alignment and domain information

>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion]	Back alignment and domain information

>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein	Back alignment and domain information

>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>TIGR02484 CitB CitB domain protein	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>PRK09477 napH quinol dehydrogenase membrane component; Provisional	Back alignment and domain information

>KOG3256\|consensus	Back alignment and domain information

>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>COG1146 Ferredoxin [Energy production and conversion]	Back alignment and domain information

>COG0348 NapH Polyferredoxin [Energy production and conversion]	Back alignment and domain information

>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion]	Back alignment and domain information

>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG	Back alignment and domain information

>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]	Back alignment and domain information

>cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase	Back alignment and domain information

>PF13484 Fer4_16: 4Fe-4S double cluster binding domain	Back alignment and domain information

>PRK15033 tricarballylate utilization protein B; Provisional	Back alignment and domain information

>TIGR02912 sulfite_red_C sulfite reductase, subunit C	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only]	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>PRK12418 cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>COG2768 Uncharacterized Fe-S center protein [General function prediction only]	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion]	Back alignment and domain information

>PF13746 Fer4_18: 4Fe-4S dicluster domain	Back alignment and domain information

>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>TIGR00435 cysS cysteinyl-tRNA synthetase	Back alignment and domain information

>CHL00065 psaC photosystem I subunit VII	Back alignment and domain information

>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>PF13746 Fer4_18: 4Fe-4S dicluster domain	Back alignment and domain information

>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only	Back alignment and domain information

>cd07030 RNAP_D D subunit of Archaeal RNA polymerase	Back alignment and domain information

>PRK11893 methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>PRK00783 DNA-directed RNA polymerase subunit D; Provisional	Back alignment and domain information

>PRK00260 cysS cysteinyl-tRNA synthetase; Validated	Back alignment and domain information

>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional	Back alignment and domain information

>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>PLN02946 cysteine-tRNA ligase	Back alignment and domain information

>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>PLN02610 probable methionyl-tRNA synthetase	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>PRK08493 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK12451 arginyl-tRNA synthetase; Reviewed	Back alignment and domain information

>TIGR00398 metG methionyl-tRNA synthetase	Back alignment and domain information

>COG1456 CdhE CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) [Energy production and conversion]	Back alignment and domain information

>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete	Back alignment and domain information

>PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PRK09326 F420H2 dehydrogenase subunit F; Provisional	Back alignment and domain information

>PTZ00399 cysteinyl-tRNA-synthetase; Provisional	Back alignment and domain information

>TIGR00456 argS arginyl-tRNA synthetase	Back alignment and domain information

>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family	Back alignment and domain information

>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG4871 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>PRK00133 metG methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PF06902 Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro: IPR010693 This entry represents bacterial ferredoxins such Ferredoxin-1, -2 and -soy from Streptomyces griseolus and Ferredoxin fas2 from Rhodococcus fascians, plus several bacterial hypothetical proteins that contain three highly conserved cysteine residues	Back alignment and domain information

>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

>PRK12267 methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK12268 methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein	Back alignment and domain information

>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma	Back alignment and domain information

>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit	Back alignment and domain information

>PLN02286 arginine-tRNA ligase	Back alignment and domain information

>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only]	Back alignment and domain information

>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit	Back alignment and domain information

>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C	Back alignment and domain information

>PF13459 Fer4_15: 4Fe-4S single cluster domain	Back alignment and domain information

>TIGR02486 RDH reductive dehalogenase	Back alignment and domain information

>PLN02224 methionine-tRNA ligase	Back alignment and domain information

>cd02156 nt_trans nucleotidyl transferase superfamily	Back alignment and domain information

>COG2000 Predicted Fe-S protein [General function prediction only]	Back alignment and domain information

>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion]	Back alignment and domain information

>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA	Back alignment and domain information

>TIGR00276 iron-sulfur cluster binding protein, putative	Back alignment and domain information

>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A	Back alignment and domain information

>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated	Back alignment and domain information

>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N	Back alignment and domain information

>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases	Back alignment and domain information

>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		582
1o0b_A		554	Crystal Structure Of L-Glutamine And Ampcpp Bound T		2e-89
1gsg_P		553	Structure Of E.Coli Glutaminyl-Trna Synthetase Comp		2e-89
1qru_A		553	Glutaminyl-Trna Synthetase Mutant I129t Complexed W		2e-89
1euq_A		548	Crystal Structure Of Glutaminyl-Trna Synthetase Com		2e-89
1nyl_A		539	Unliganded Glutaminyl-Trna Synthetase Length = 539		2e-89
1qrs_A		553	Glutaminyl-Trna Synthetase Mutant D235n Complexed W		7e-89
1qrt_A		553	Glutaminyl-Trna Synthetase Mutant D235g Complexed W		8e-89
2rd2_A		556	Glutaminyl-Trna Synthetase Mutant C229r With Bound		4e-88
2hz7_A		851	Crystal Structure Of The Glutaminyl-Trna Synthetase		2e-79
3aii_A		553	Archaeal Non-Discriminating Glutamyl-Trna Synthetas		3e-17
1hfe_L		421	1.6 A Resolution Structure Of The Fe-Only Hydrogena		2e-05
1e08_A		371	Structural Model Of The [fe]-HydrogenaseCYTOCHROME		4e-05
3bk7_A		607	Structure Of The Complete Abce1RNAASE-L Inhibitor P		3e-04
3j15_B		593	Model Of Ribosome-Bound Archaeal Pelota And Abce1 L		4e-04

>pdb|1O0B|A Chain A, Crystal Structure Of L-Glutamine And Ampcpp Bound To Glutamine Aminoacyl Trna Synthetase Length = 554