Diaphorina citri psyllid: psy9430

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----

MPGISRKPILIDGRGHLLGRLASIVAKTILNGNRVVVVRAELLNISGNFFRNKLKYLAFLNKRCNVNPARGPFHYRAPARIFWKTPILIDGRGHLLGRLASIVAKTILNGNRVVVVRAELLNISGNFFRNKLKYLAFLNKRCNVNPARGPFHYRAPARIFWKTVRGMTPHKLDRGAKALKRLKVYEGIPPKYARRQRLCVPTALRTVCLKPGRSYCSVGRISHEVGWKYKTIVRHLERKRREKSIEKIKLHTVYN

ccccccccEEEccccccHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHcccEEEEEEEccEEEccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccHHHHHHHccccccccccccccccccccccHHHHHHcccccccEEEHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcc

*****RK*ILIDGRGHLLGRLASIVAKTILNGNRVVVVRAELLNISGNFFRNKLKYLAFLNKRCNVNPARGPFHYRAPARIFWKTPILIDGRGHLLGRLASIVAKTILNGNRVVVVRAELLNISGNFFRNKLKYLAFLNKRCNVNPARGPFHYRAPARIFWKTVRGMTPHKLDRGAKALKRLKVYEGIPPKYARRQRLCVPTALRTVCLKPGRSYCSVGRISHEVGWKYKTIVRHLERKRREKSIEKIKLHTV**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L13a		confident	Q27389
60S ribosomal protein L13a		confident	Q3SZ90
60S ribosomal protein L13a		confident	P35427

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022625 [CC]	cytosolic large ribosomal subunit	probable	GO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0003735 [MF]	structural constituent of ribosome	probable	GO:0003674, GO:0005198
GO:0040007 [BP]	growth	probable	GO:0008150
GO:1901194 [BP]	negative regulation of formation of translation preinitiation complex	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0051129, GO:0051128, GO:0050789, GO:0044699, GO:0010608, GO:0051246, GO:0065007, GO:0048519, GO:2000112, GO:0010468, GO:0060255, GO:0006446, GO:0009987, GO:0009889, GO:0050794, GO:0008150, GO:1901193, GO:0032268, GO:0044087, GO:0010556, GO:0006417, GO:0044763, GO:0048523
GO:0071346 [BP]	cellular response to interferon-gamma	probable	GO:0002376, GO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0045087, GO:0009987, GO:0006950, GO:0034341, GO:0006952, GO:0071310, GO:0044763, GO:0008150, GO:0070887, GO:0006955, GO:0042221, GO:0010033, GO:0044699
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0032040 [CC]	small-subunit processome	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0043581 [BP]	mycelium development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0007154 [BP]	cell communication	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006412 [BP]	translation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain j
Confidence level:very confident
Coverage over the Query: 87-222
View the alignment between query and template
View the model in PyMOL

Template: 2ZKR, chain j
Confidence level:very confident
Coverage over the Query: 9-108
View the alignment between query and template
View the model in PyMOL