Diaphorina citri psyllid: psy9431


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MFESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPKVGAKGKSDSLRYEYDDHYFLTDPREFIYEFFPLQPEWRTHVYQASVLTTTPPR
ccccccccEEEEEEccccccccccccccccccccccEEEEEEccEEEEEEccccccccccccccccccccccccccEEccccCEccccHHccHHccccccccccccccccccccccccc
*FESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPK*GA*GKSDSLRYEYDDHYFLTDPREFIYEFFPLQPEWRTHVYQASVLTTTP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFESYAGLHCVVIKGYSKSAGYQPGVKFEDNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPKVGAKGKSDSLRYEYDDHYFLTDPREFIYEFFPLQPEWRTHVYQASVLTTTPPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ISR, chain A
Confidence level:confident
Coverage over the Query: 2-56
View the alignment between query and template
View the model in PyMOL