Diaphorina citri psyllid: psy9436

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MIAVALSIEDTRLATLVTEKTTSTKRNIGHFDRKRKQARHESKIRAVEKLELFSIENARNQSESMTPHKLDRGAKALKRLKVYEGIPPKYARRQRLCVPTALRTVCLKPGRSYCSVGRISHEVGWKYKTIVRHLERKRREKSIEKIKLHTVYLIPCLDCESNLTKKAGKQVKKATFPLTKQINTFGYK
cEEEEEEEcccEEEEEEEcccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHcccccccEEccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccc
*IAVA**IEDTRLATLVTEKTTSTKRNIGHFDRKRKQ*****KIRAVEKLELFSIENARNQSESMTPHKLDRGAKALKRLKVYEGIPPKYARRQRLCVPTALRTVCLKPGRSYCSVGRISHEVGWKYKTIVRHLERKRREKSIEKIKLHTVYLIPCLDCESNLTKKAG**VKKATFPLTKQINTFGY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAVALSIEDTRLATLVTEKTTSTKRNIGHFDRKRKQARHESKIRAVEKLELFSIENARNQSESMTPHKLDRGAKALKRLKVYEGIPPKYARRQRLCVPTALRTVCLKPGRSYCSVGRISHEVGWKYKTIVRHLERKRREKSIEKIKLHTVYLIPCLDCESNLTKKAGKQVKKATFPLTKQINTFGYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L13a confidentP35427
60S ribosomal protein L13a confidentP40429
60S ribosomal protein L13a confidentQ5RA38

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain j
Confidence level:very confident
Coverage over the Query: 31-120
View the alignment between query and template
View the model in PyMOL