Diaphorina citri psyllid: psy949

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------57
MSNSVRHQSSYQDKLLYEYDHWDDAIHGFRETERSKWNEENTKIIARVQNLAFPPNVTPIQYVHVLDLEQKGYIKAHKGYIKAHVDSVRFCGNTIAGLSLLSDSVMKLVDEKTKTQEILVLLKQRSLYVMKDDARYKFTHEVLENERSYFGDLFVPRGRRISVICRNTPDPSLIDSSSDTSTNNNPYASMFYIFFQPRLPEPDLIRLDSSDDVLPTSSQCAGVENPLYPYFVPKNLQPQPEKQEEASGSNSSSNSFKQNMDFFSNLSNSSSSQLKSPPSRPSSNYHKAFSFHGKSQDTSNSFDFLTSSSTHPTHTNGFTTSSISSTFPSEPLPSSQPKVLSTFMNHSQPPPLSPRKLNNTESKQNLPLNNLPVNAPRLPLVPTVGPPSYLSYPKPPVLNNGFSHPVQVSRPPSYLSYPKPPVLNNGFSHPVQVSSNSSSSEFNSEAKDFFDSILNNNSTTYPSVAQRNGVFASKPSTSTYASRAAFLNEQLGPAVPSIAPKKSVICTSRRHKIFWWKSNKSPCAKFVLHVRSFMRSSQKYIRAAFLNEQLGPAVPSIAPKNVCRIYWNP
cccHHHHHHHHHcccccccccHHHHHccccccccccccHHHHHHHHHHHHHccccccccccccEEccccccccccccccccccccccccccccEEEEEEccccEEEEEEEcccccEEEEEEEcccEEEEEccccccccccccccccccccccCEcccccEEEEEEcccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccEEEEccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcccc
****V**QSSYQDKLLYEYDHWDDAIHGFRETERSKWNEENTKIIARVQNLAFPPNVTPIQYVHVLDLEQKGYIKAHKGYIKAHVDSVRFCGNTIAGLSLLSDSVMKLVDEKTKTQEILVLLKQRSLYVMKDDARYKFTHEVLENERSYFGDLFVPRGRRISVICRNTP*****************YASMFYIFFQPRLPEPDLIRLDSSDDVLPTSSQCAGVENPLYPYFV**********************************************************************DFLTSSSTHPTHTNGFTT******************************************************APRLPLVPTVGPPSYLSYPKPPVLNNGFSHPVQVSRPPSYLSYPKPPVLNNGFS*******************DFFDSILNNNSTTYPSVAQRNGVFASKPSTSTYASRAAFLNEQLGPAVPSIAPKKSVICTSRRHKIFWWKSNKSPCAKFVLHVRSFMRSSQKYIRAAFLNEQLGPAVPSIAPKNVCRIYWNP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNSVRHQSSYQDKLLYEYDHWDDAIHGFRETERSKWNEENTKIIARVQNLAFPPNVTPIQYVHVLDLEQKGYIKAHKGYIKAHVDSVRFCGNTIAGLSLLSDSVMKLVDEKTKTQEILVLLKQRSLYVMKDDARYKFTHEVLENERSYFGDLFVPRGRRISVICRNTPDPSLIDSSSDTSTNNNPYASMFYIFFQPRLPEPDLIRLDSSDDVLPTSSQCAGVENPLYPYFVPKNLQPQPEKQEEASGSNSSSNSFKQNMDFFSNLSNSSSSQLKSPPSRPSSNYHKAFSFHGKSQDTSNSFDFLTSSSTHPTHTNGFTTSSISSTFPSEPLPSSQPKVLSTFMNHSQPPPLSPRKLNNTESKQNLPLNNLPVNAPRLPLVPTVGPPSYLSYPKPPVLNNGFSHPVQVSRPPSYLSYPKPPVLNNGFSHPVQVSSNSSSSEFNSEAKDFFDSILNNNSTTYPSVAQRNGVFASKPSTSTYASRAAFLNEQLGPAVPSIAPKKSVICTSRRHKIFWWKSNKSPCAKFVLHVRSFMRSSQKYIRAAFLNEQLGPAVPSIAPKNVCRIYWNP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-ketoglutarate-dependent dioxygenase alkB homolog 7 Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.confidentQ9D6Z0
Alpha-ketoglutarate-dependent dioxygenase alkB homolog 7 Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.confidentQ9BT30
Alpha-ketoglutarate-dependent dioxygenase alkB homolog 7 Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.confidentQ2M2S8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016706 [MF]oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donorsprobableGO:0003824, GO:0016705, GO:0003674, GO:0051213, GO:0016491
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3THT, chain A
Confidence level:very confident
Coverage over the Query: 35-176
View the alignment between query and template
View the model in PyMOL
Template: 3ITQ, chain A
Confidence level:probable
Coverage over the Query: 3-13,25-145,156-167
View the alignment between query and template
View the model in PyMOL