Diaphorina citri psyllid: psy9509

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MRRRGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE
ccccccccHHHHHHHHHHccccccEEEEEccccccHHHHHHHHcccccEEEECccccccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHcccccEEEEHHHHHcccccccccEEEEcccccccccccccccccccccccccEEEEccccc
MRRRGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRRGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004004 [MF]ATP-dependent RNA helicase activityprobableGO:0016787, GO:0016818, GO:0008026, GO:0042623, GO:0003824, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003724, GO:0003674, GO:0016887, GO:0008186, GO:0016462
GO:0045495 [CC]pole plasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008150 [BP]biological_processprobable
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DB3, chain A
Confidence level:very confident
Coverage over the Query: 5-55,82-136,147-230
View the alignment between query and template
View the model in PyMOL
Template: 2VSO, chain A
Confidence level:probable
Coverage over the Query: 12-35,53-124,135-231
View the alignment between query and template
View the model in PyMOL