Psyllid ID: psy9509

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MRRRGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE
ccccccccHHHHHHHHHHccccccEEEEEccccccHHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHcccccEEEEHHHHHcccccccccEEEEcccccccccccccccccccccccccEEEEccccc
ccccccccHHHHHHHHHHccHHHcEEEEEccccHHHHHHHHHHHcccEEEEEcccccccccccccEEEEcccEEEEEEEcHHcccccEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHccccEEEEEEHHHHcccccccccEEEEEcccccHcHHEEEEcccccccccEEEEEEEcccc
mrrrgvggLVIMWDtfltypsrpqrllfsatlshdpeklhqlslfqpklftsvvepagtgdtqptsseagadnlssgfigkfttpaelseklttcstnlkpLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIdnvatkgagtkMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVAsdnlargidvenidvvinyeapdniKKYIHRIgrtarggrqgtsVTLVTTHE
MRRRGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNvatkgagtkMNIAEvysdlkfdQRNKIIQefrrrkidlvvasdnlargidvenidvvinyeapdnikKYIHRigrtarggrqgtsvtlvtthe
MRRRGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE
*****VGGLVIMWDTFLTYPSRPQRLLFSATLSHD**KLHQLSLFQPKLFTSV************************FIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTA****************
MRRRGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDL******KIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTH*
MRRRGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAG***********GADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTAR***************
***RGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRRGVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query231 2.2.26 [Sep-21-2011]
P26802 687 Probable ATP-dependent RN yes N/A 0.883 0.296 0.422 4e-42
Q6P9R1639 ATP-dependent RNA helicas yes N/A 0.818 0.295 0.387 3e-35
Q8N8A6666 ATP-dependent RNA helicas yes N/A 0.813 0.282 0.382 4e-35
Q6DRI7652 ATP-dependent RNA helicas yes N/A 0.844 0.299 0.369 6e-33
Q76PD3604 ATP-dependent RNA helicas yes N/A 0.878 0.336 0.386 4e-32
Q0DWT8521 DEAD-box ATP-dependent RN yes N/A 0.779 0.345 0.325 1e-24
Q54BD6 563 Probable ATP-dependent RN yes N/A 0.822 0.337 0.313 2e-24
P34668593 Putative ATP-dependent RN yes N/A 0.818 0.318 0.313 2e-24
A3LSJ2591 ATP-dependent RNA helicas yes N/A 0.783 0.306 0.339 2e-22
Q7FGZ2522 DEAD-box ATP-dependent RN yes N/A 0.779 0.344 0.319 3e-22
>sp|P26802|DDX51_DROME Probable ATP-dependent RNA helicase Dbp73D OS=Drosophila melanogaster GN=Dbp73D PE=2 SV=3 Back     alignment and function desciption
 Score =  171 bits (433), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 138/218 (63%), Gaps = 14/218 (6%)

Query: 18  TYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLS-- 75
           ++  +P +LLFSATLS DPEKL  L LFQP+LF +V+      D    ++E GAD  +  
Sbjct: 349 SFGKQPHKLLFSATLSQDPEKLQDLRLFQPRLFATVLTMPVLKD----ATEEGADTEALT 404

Query: 76  --SGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLL 133
               F+G++TTPAEL+E+       LKPL ++ L+ K+  +  LCF N++  A RL  +L
Sbjct: 405 DPGQFVGRYTTPAELTEQYCVTELRLKPLTVFALVEKYKWKRFLCFTNSSDQATRLTFVL 464

Query: 134 HHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENID 193
                V  +   TK  ++E+  +L    RN+ +++F   KI+ ++ SD LARGIDV ++D
Sbjct: 465 ----KVLFQKYSTK--VSELSGNLSAKVRNERLRDFAAGKINGLICSDALARGIDVADVD 518

Query: 194 VVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE 231
           VV++YE P +I  YIHR+GRTAR GR+GT+VT++T  +
Sbjct: 519 VVLSYETPRHITTYIHRVGRTARAGRKGTAVTVLTEQD 556
ATP-binding RNA helicase involved in the biogenesis of 60S ribosomal subunits.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q6P9R1|DDX51_MOUSE ATP-dependent RNA helicase DDX51 OS=Mus musculus GN=Ddx51 PE=2 SV=1 Back     alignment and function description
>sp|Q8N8A6|DDX51_HUMAN ATP-dependent RNA helicase DDX51 OS=Homo sapiens GN=DDX51 PE=1 SV=3 Back     alignment and function description
>sp|Q6DRI7|DDX51_DANRE ATP-dependent RNA helicase DDX51 OS=Danio rerio GN=ddx51 PE=2 SV=1 Back     alignment and function description
>sp|Q76PD3|DBP6_SCHPO ATP-dependent RNA helicase dbp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp6 PE=2 SV=1 Back     alignment and function description
>sp|Q0DWT8|RH1_ORYSJ DEAD-box ATP-dependent RNA helicase 1 OS=Oryza sativa subsp. japonica GN=Os02g0795900 PE=2 SV=1 Back     alignment and function description
>sp|Q54BD6|DDX51_DICDI Probable ATP-dependent RNA helicase ddx51 OS=Dictyostelium discoideum GN=ddx51 PE=3 SV=1 Back     alignment and function description
>sp|P34668|YO12_CAEEL Putative ATP-dependent RNA helicase ZK686.2 OS=Caenorhabditis elegans GN=ZK686.2 PE=3 SV=2 Back     alignment and function description
>sp|A3LSJ2|DBP6_PICST ATP-dependent RNA helicase DBP6 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP6 PE=3 SV=2 Back     alignment and function description
>sp|Q7FGZ2|RH1_ARATH DEAD-box ATP-dependent RNA helicase 1 OS=Arabidopsis thaliana GN=RH1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
195014606 675 GH15223 [Drosophila grimshawi] gi|193897 0.926 0.317 0.44 4e-45
195376467 680 GJ12159 [Drosophila virilis] gi|19415417 0.930 0.316 0.447 5e-45
194750630 683 GF10505 [Drosophila ananassae] gi|190624 0.883 0.298 0.455 2e-44
328702076 528 PREDICTED: probable ATP-dependent RNA he 0.887 0.388 0.454 3e-44
193596603 528 PREDICTED: probable ATP-dependent RNA he 0.887 0.388 0.454 3e-44
198463449 697 GA21960 [Drosophila pseudoobscura pseudo 0.952 0.315 0.425 5e-44
195127527 670 GI11933 [Drosophila mojavensis] gi|19391 0.930 0.320 0.437 7e-44
242019954 518 DEAD box ATP-dependent RNA helicase, put 0.896 0.399 0.405 8e-44
195495021 681 GE22191 [Drosophila yakuba] gi|194181191 0.883 0.299 0.436 1e-41
91092858 601 PREDICTED: similar to ATP-dependent RNA 0.818 0.314 0.438 2e-41
>gi|195014606|ref|XP_001984044.1| GH15223 [Drosophila grimshawi] gi|193897526|gb|EDV96392.1| GH15223 [Drosophila grimshawi] Back     alignment and taxonomy information
 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 142/225 (63%), Gaps = 11/225 (4%)

Query: 5   GVGGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQP 64
           GV   +   +   +Y  +P +LLFSATLS DPEKL  L LFQPKLFT+V     T    P
Sbjct: 339 GVQAPLCYQELLNSYGKQPHKLLFSATLSQDPEKLQNLRLFQPKLFTTVF----TLPVLP 394

Query: 65  TSSE-AGADNLSSGFIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTA 123
           ++ + A     SS FIGK+TTP EL+E+       LKPL LY +++ +  +  LCF N+A
Sbjct: 395 SALDIAELPEQSSQFIGKYTTPTELTEQYCVTELRLKPLTLYTMVQTYGWKRFLCFTNSA 454

Query: 124 QGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNL 183
             A RLA +L H+        G+ + + E+ +++K   R + + +F +  I  +V SD L
Sbjct: 455 DTADRLAFVLKHLFQ------GSPITVEELSANMKVGVRARRLADFAKGSIHGLVCSDAL 508

Query: 184 ARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVT 228
           ARGIDV N+D+V++YEAP +IK YIHR+GRTAR G++GT++TL+T
Sbjct: 509 ARGIDVPNVDIVLSYEAPRHIKTYIHRVGRTARAGQKGTAITLLT 553

Source: Drosophila grimshawi

Species: Drosophila grimshawi

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195376467|ref|XP_002047018.1| GJ12159 [Drosophila virilis] gi|194154176|gb|EDW69360.1| GJ12159 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194750630|ref|XP_001957633.1| GF10505 [Drosophila ananassae] gi|190624915|gb|EDV40439.1| GF10505 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|328702076|ref|XP_001949723.2| PREDICTED: probable ATP-dependent RNA helicase Dbp73D-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193596603|ref|XP_001949748.1| PREDICTED: probable ATP-dependent RNA helicase Dbp73D-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|198463449|ref|XP_001352828.2| GA21960 [Drosophila pseudoobscura pseudoobscura] gi|198151259|gb|EAL30329.2| GA21960 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195127527|ref|XP_002008220.1| GI11933 [Drosophila mojavensis] gi|193919829|gb|EDW18696.1| GI11933 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|242019954|ref|XP_002430423.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi|212515553|gb|EEB17685.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195495021|ref|XP_002095090.1| GE22191 [Drosophila yakuba] gi|194181191|gb|EDW94802.1| GE22191 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|91092858|ref|XP_969365.1| PREDICTED: similar to ATP-dependent RNA helicase DDX51 [Tribolium castaneum] gi|270003080|gb|EEZ99527.1| hypothetical protein TcasGA2_TC000109 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
FB|FBgn0004556 687 Dbp73D "Dead box protein 73D" 0.900 0.302 0.415 1.3e-38
POMBASE|SPCC285.03604 SPCC285.03 "ATP-dependent RNA 0.878 0.336 0.386 1e-29
UNIPROTKB|F1MGC9546 DDX51 "Uncharacterized protein 0.683 0.289 0.364 2.9e-24
MGI|MGI:1916913639 Ddx51 "DEAD (Asp-Glu-Ala-Asp) 0.601 0.217 0.371 4e-24
UNIPROTKB|E2R5R1631 DDX51 "Uncharacterized protein 0.601 0.220 0.398 4.4e-24
DICTYBASE|DDB_G0293740 563 ddx51 "DEAD/DEAH box helicase" 0.636 0.261 0.362 7.8e-24
UNIPROTKB|Q8N8A6666 DDX51 "ATP-dependent RNA helic 0.636 0.220 0.365 6e-23
RGD|1309580635 Ddx51 "DEAD (Asp-Glu-Ala-Asp) 0.606 0.220 0.369 8.8e-23
WB|WBGene00022792593 ZK686.2 [Caenorhabditis elegan 0.818 0.318 0.313 9.5e-23
TAIR|locus:2130839522 RH1 "RNA helicase 1" [Arabidop 0.623 0.275 0.331 3.4e-22
FB|FBgn0004556 Dbp73D "Dead box protein 73D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 418 (152.2 bits), Expect = 1.3e-38, P = 1.3e-38
 Identities = 89/214 (41%), Positives = 134/214 (62%)

Query:    18 TYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSG 77
             ++  +P +LLFSATLS DPEKL  L LFQP+LF +V+      D     ++  A      
Sbjct:   349 SFGKQPHKLLFSATLSQDPEKLQDLRLFQPRLFATVLTMPVLKDATEEGADTEALTDPGQ 408

Query:    78 FIGKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHID 137
             F+G++TTPAEL+E+       LKPL ++ L+ K+  +  LCF N++  A RL  +L    
Sbjct:   409 FVGRYTTPAELTEQYCVTELRLKPLTVFALVEKYKWKRFLCFTNSSDQATRLTFVL---- 464

Query:   138 NVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVIN 197
              V  +   TK  ++E+  +L    RN+ +++F   KI+ ++ SD LARGIDV ++DVV++
Sbjct:   465 KVLFQKYSTK--VSELSGNLSAKVRNERLRDFAAGKINGLICSDALARGIDVADVDVVLS 522

Query:   198 YEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE 231
             YE P +I  YIHR+GRTAR GR+GT+VT++T  +
Sbjct:   523 YETPRHITTYIHRVGRTARAGRKGTAVTVLTEQD 556
GO:0004004 "ATP-dependent RNA helicase activity" evidence=NAS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
POMBASE|SPCC285.03 SPCC285.03 "ATP-dependent RNA helicase Dbp6 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGC9 DDX51 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1916913 Ddx51 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 51" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5R1 DDX51 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293740 ddx51 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N8A6 DDX51 "ATP-dependent RNA helicase DDX51" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309580 Ddx51 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 51" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00022792 ZK686.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2130839 RH1 "RNA helicase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-33
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-30
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-22
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-21
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-21
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 5e-18
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 7e-18
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-17
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 4e-17
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-14
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-14
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 1e-13
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-13
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 4e-13
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-12
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 2e-07
COG1205 851 COG1205, COG1205, Distinct helicase family with a 3e-07
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 7e-07
TIGR00614 470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 3e-06
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 1e-05
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 2e-05
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 3e-05
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 6e-05
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 1e-04
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase re 2e-04
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 0.003
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  125 bits (315), Expect = 2e-33
 Identities = 56/213 (26%), Positives = 97/213 (45%), Gaps = 35/213 (16%)

Query: 20  PSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFI 79
           P   Q LLFSAT+  D                 + E A      P   E   + L     
Sbjct: 203 PPDRQTLLFSATMPDD-----------------IRELARRYLNDPVEIEVSVEKLER--- 242

Query: 80  GKFTTPAELSEKLTTCST-NLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDN 138
               T  ++ +      +   K  +L +L++      V+ FV T +    LA  L     
Sbjct: 243 ----TLKKIKQFYLEVESEEEKLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKR-- 296

Query: 139 VATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINY 198
                      +A ++ DL  ++R++ +++F+  ++ ++VA+D  ARG+D+ ++  VINY
Sbjct: 297 --------GFKVAALHGDLPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINY 348

Query: 199 EAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE 231
           + P + + Y+HRIGRT R GR+G +++ VT  E
Sbjct: 349 DLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEE 381

Length = 513
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 231
KOG0328|consensus400 100.0
KOG0331|consensus519 100.0
KOG0330|consensus476 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0333|consensus673 100.0
KOG0343|consensus 758 100.0
KOG0326|consensus459 100.0
KOG0345|consensus 567 100.0
KOG0342|consensus 543 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0336|consensus629 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0341|consensus610 100.0
KOG0332|consensus477 100.0
KOG0340|consensus442 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0335|consensus482 100.0
KOG0338|consensus 691 100.0
KOG0348|consensus 708 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0346|consensus 569 100.0
KOG0327|consensus397 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.97
KOG0339|consensus 731 99.97
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.97
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.97
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.97
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.97
KOG0334|consensus 997 99.96
KOG0344|consensus593 99.96
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.96
KOG0347|consensus 731 99.96
KOG4284|consensus 980 99.96
KOG0350|consensus620 99.96
KOG0337|consensus 529 99.95
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.95
PRK10689 1147 transcription-repair coupling factor; Provisional 99.94
PHA02653 675 RNA helicase NPH-II; Provisional 99.94
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.94
PRK13767 876 ATP-dependent helicase; Provisional 99.93
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.93
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.93
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.93
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.93
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.93
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.92
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.92
KOG0351|consensus 941 99.92
PRK02362 737 ski2-like helicase; Provisional 99.92
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.9
PRK00254 720 ski2-like helicase; Provisional 99.9
COG1202 830 Superfamily II helicase, archaea-specific [General 99.89
PRK04914 956 ATP-dependent helicase HepA; Validated 99.89
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.89
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.89
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.89
PRK01172 674 ski2-like helicase; Provisional 99.89
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.87
KOG0352|consensus 641 99.87
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.87
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.87
KOG0329|consensus387 99.87
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.86
PHA02558501 uvsW UvsW helicase; Provisional 99.86
KOG0349|consensus 725 99.86
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.86
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.85
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.85
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.84
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.84
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.84
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.82
PRK05298652 excinuclease ABC subunit B; Provisional 99.82
PRK13766 773 Hef nuclease; Provisional 99.82
PRK09401 1176 reverse gyrase; Reviewed 99.81
KOG0353|consensus 695 99.8
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.8
COG1204 766 Superfamily II helicase [General function predicti 99.79
PRK14701 1638 reverse gyrase; Provisional 99.79
KOG0354|consensus 746 99.77
PRK09694 878 helicase Cas3; Provisional 99.77
smart0049082 HELICc helicase superfamily c-terminal domain. 99.75
KOG0947|consensus 1248 99.75
KOG0950|consensus 1008 99.74
COG1205 851 Distinct helicase family with a unique C-terminal 99.74
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.71
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.71
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.71
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.7
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.68
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.68
KOG0948|consensus 1041 99.67
KOG0922|consensus 674 99.67
PRK05580 679 primosome assembly protein PriA; Validated 99.67
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.66
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.66
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.66
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.64
KOG4150|consensus 1034 99.63
KOG0952|consensus 1230 99.61
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.61
KOG0951|consensus 1674 99.57
KOG0920|consensus 924 99.54
KOG1123|consensus 776 99.52
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.48
KOG0924|consensus 1042 99.46
KOG0923|consensus 902 99.46
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.41
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.36
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.35
KOG0926|consensus 1172 99.29
KOG0385|consensus 971 99.29
KOG0953|consensus 700 99.27
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.24
KOG0384|consensus 1373 99.22
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.21
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.2
KOG0387|consensus 923 99.18
KOG0390|consensus776 99.12
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.1
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.08
KOG0925|consensus 699 99.07
KOG0389|consensus941 99.02
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.99
KOG0392|consensus1549 98.93
KOG0391|consensus 1958 98.9
KOG0388|consensus1185 98.88
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.86
KOG0949|consensus 1330 98.84
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.8
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.76
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.75
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.69
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.68
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.65
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.64
KOG1015|consensus 1567 98.55
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.44
KOG1000|consensus689 98.43
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.42
KOG0386|consensus 1157 98.4
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.33
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 98.31
COG4096 875 HsdR Type I site-specific restriction-modification 98.31
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.31
KOG1002|consensus791 98.3
KOG4439|consensus901 98.19
COG4889 1518 Predicted helicase [General function prediction on 97.83
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 97.83
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.69
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.66
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.61
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.49
KOG1016|consensus 1387 97.47
PF13871 278 Helicase_C_4: Helicase_C-like 97.43
PRK14873 665 primosome assembly protein PriA; Provisional 97.14
PRK05580 679 primosome assembly protein PriA; Validated 97.11
TIGR00595 505 priA primosomal protein N'. All proteins in this f 97.07
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 96.97
PRK14873 665 primosome assembly protein PriA; Provisional 96.96
KOG0921|consensus 1282 96.9
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 96.8
COG1198 730 PriA Primosomal protein N' (replication factor Y) 96.64
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 96.6
KOG1001|consensus674 96.58
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 96.43
KOG0701|consensus 1606 96.37
PRK10689 1147 transcription-repair coupling factor; Provisional 95.68
PRK14701 1638 reverse gyrase; Provisional 95.32
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 95.17
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 95.03
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 94.76
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 94.74
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 94.7
KOG0951|consensus 1674 94.24
KOG1513|consensus 1300 94.08
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 93.18
KOG0347|consensus 731 92.94
KOG2340|consensus698 92.76
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 92.73
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 92.44
KOG0330|consensus 476 91.81
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 91.74
PRK09401 1176 reverse gyrase; Reviewed 91.54
KOG0331|consensus 519 90.63
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 90.22
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 90.21
TIGR00696177 wecB_tagA_cpsF bacterial polymer biosynthesis prot 90.12
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 89.95
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 89.78
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 89.15
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 88.68
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 88.49
KOG0339|consensus 731 88.42
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 87.77
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 87.59
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 87.26
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 86.86
PTZ00110 545 helicase; Provisional 86.58
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 86.51
KOG0348|consensus 708 86.06
KOG0343|consensus 758 86.01
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 85.14
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 83.07
PRK05298 652 excinuclease ABC subunit B; Provisional 82.66
KOG0298|consensus1394 82.15
KOG0329|consensus 387 81.43
KOG0338|consensus 691 81.02
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 80.86
KOG0335|consensus 482 80.65
COG1922253 WecG Teichoic acid biosynthesis proteins [Cell env 80.63
KOG1133|consensus821 80.62
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 80.5
KOG0383|consensus696 80.43
>KOG0328|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.3e-42  Score=262.14  Aligned_cols=189  Identities=27%  Similarity=0.448  Sum_probs=175.0

Q ss_pred             cceeeeeccccCCCCCCcEEEEeeecCCChhhhhcccccCCeEEeeeccCCCCCCCCCCCcccccCCCCCcccccccCcc
Q psy9509           7 GGLVIMWDTFLTYPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKFTTPA   86 (231)
Q Consensus         7 ~~~~~~~~i~~~~~~~~q~il~SATl~~~~~~~~~~~~~~p~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   86 (231)
                      +|...+.++++++|+..|++++|||+|.++.+...++|.+|..+.+...                          ..+.+
T Consensus       185 gfk~Qiydiyr~lp~~~Qvv~~SATlp~eilemt~kfmtdpvrilvkrd--------------------------eltlE  238 (400)
T KOG0328|consen  185 GFKEQIYDIYRYLPPGAQVVLVSATLPHEILEMTEKFMTDPVRILVKRD--------------------------ELTLE  238 (400)
T ss_pred             hHHHHHHHHHHhCCCCceEEEEeccCcHHHHHHHHHhcCCceeEEEecC--------------------------CCchh
Confidence            6777889999999999999999999999999999999999999887622                          23456


Q ss_pred             cccceeeecCCCC-hHHHHHHHHHhcCCCcEEEEEcchHHHHHHHHHHhhhccccccCCCCcccEEEEcCCCCHHHHHHH
Q psy9509          87 ELSEKLTTCSTNL-KPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKI  165 (231)
Q Consensus        87 ~~~~~~~~~~~~~-k~~~l~~ll~~~~~~~~iIF~~s~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~h~~~~~~~r~~~  165 (231)
                      .++++|+.++.++ |.+.|..+.....-.+++|||||+..++.+.+.+++.          ++.+...||+|++++|+++
T Consensus       239 gIKqf~v~ve~EewKfdtLcdLYd~LtItQavIFcnTk~kVdwLtekm~~~----------nftVssmHGDm~qkERd~i  308 (400)
T KOG0328|consen  239 GIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA----------NFTVSSMHGDMEQKERDKI  308 (400)
T ss_pred             hhhhheeeechhhhhHhHHHHHhhhhehheEEEEecccchhhHHHHHHHhh----------CceeeeccCCcchhHHHHH
Confidence            7999999887655 9999999999988889999999999999999999987          8899999999999999999


Q ss_pred             HHHHHcCCccEEEEcCccccccCcCCCcEEEEecCCCCHHHHHHHhcccccCCCCceEEEEeecCC
Q psy9509         166 IQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE  231 (231)
Q Consensus       166 ~~~f~~~~~~vlv~T~~~~~Gidi~~v~~vi~~~~p~~~~~~~qr~GR~gR~g~~g~~~~~~~~~~  231 (231)
                      +.+|++|+.+||++|++.+||+|+|.|++|||||.|...+.|+||+||.||.|++|.++.|+..+|
T Consensus       309 m~dFRsg~SrvLitTDVwaRGiDv~qVslviNYDLP~nre~YIHRIGRSGRFGRkGvainFVk~~d  374 (400)
T KOG0328|consen  309 MNDFRSGKSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDD  374 (400)
T ss_pred             HHHhhcCCceEEEEechhhccCCcceeEEEEecCCCccHHHHhhhhccccccCCcceEEEEecHHH
Confidence            999999999999999999999999999999999999999999999999999999999999997654

>KOG0331|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>COG1922 WecG Teichoic acid biosynthesis proteins [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 9e-17
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 5e-16
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 4e-15
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 5e-15
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 8e-15
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 8e-15
2hyi_C413 Structure Of The Human Exon Junction Complex With A 8e-15
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 9e-15
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 8e-14
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 1e-13
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 3e-13
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-12
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 1e-12
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-12
2jgn_A185 Ddx3 Helicase Domain Length = 185 3e-12
1fuu_A394 Yeast Initiation Factor 4a Length = 394 4e-12
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 1e-11
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-11
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 1e-11
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 1e-11
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-11
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 2e-11
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 2e-11
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 3e-11
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 5e-11
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 7e-11
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 7e-11
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 7e-11
4db4_A 256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 2e-10
4db2_C 257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 2e-10
4db2_A 257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 3e-10
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 3e-10
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 4e-10
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 5e-10
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 6e-10
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 1e-09
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 3e-09
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 4e-09
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 4e-09
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 4e-09
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 4e-09
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 5e-09
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 1e-06
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 2e-06
1oyy_A 523 Structure Of The Recq Catalytic Core Bound To Atp-G 1e-05
1oyw_A 523 Structure Of The Recq Catalytic Core Length = 523 2e-05
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 1e-04
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure 
Iteration: 1

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 86/164 (52%), Gaps = 16/164 (9%)
Query: 73  NLSSGFIGKFT-----TPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAH 127
           NL+  + G ++       A + +     + N +   L +L++     G L F  T +   
Sbjct: 194 NLAKKYXGDYSFIKAKINANIEQSYVEVNENERFEALCRLLKNKEFYG-LVFCKTKRDTK 252
Query: 128 RLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGI 187
            LA  L  I   A  GA        ++ DL   QR K+I+ F+++KI +++A+D  +RGI
Sbjct: 253 ELASXLRDIGFKA--GA--------IHGDLSQSQREKVIRLFKQKKIRILIATDVXSRGI 302
Query: 188 DVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE 231
           DV +++ VINY  P N + Y HRIGRT R G++G +++++   E
Sbjct: 303 DVNDLNCVINYHLPQNPESYXHRIGRTGRAGKKGKAISIINRRE 346
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-37
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 3e-36
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 1e-32
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 5e-32
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 8e-31
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 2e-30
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 3e-30
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 5e-30
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-29
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-29
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 7e-29
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-28
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 2e-28
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-28
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 5e-28
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 6e-28
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-27
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 4e-27
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 6e-27
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 6e-26
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 7e-26
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-25
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 2e-24
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 2e-24
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 4e-19
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-17
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 5e-10
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 6e-10
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 9e-10
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-09
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 1e-08
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 5e-05
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 3e-04
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
 Score =  136 bits (345), Expect = 1e-37
 Identities = 43/212 (20%), Positives = 83/212 (39%), Gaps = 23/212 (10%)

Query: 20  PSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFI 79
               + LLFSATL    +KL    + + +            +          + +    +
Sbjct: 262 ADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEA--------HERIDQSVV 313

Query: 80  GKFTTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNV 139
                 +E               +  Q+  + +    + F  T +    L  +L +    
Sbjct: 314 -----ISEKFANSIFA---AVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKK 365

Query: 140 ATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYE 199
                   + I E +  +  ++R  +++ F++ +  ++V +D  ARG+D  N+  V+   
Sbjct: 366 -------DLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIG 418

Query: 200 APDNIKKYIHRIGRTARGGRQGTSVTLVTTHE 231
            P  +  YIHRIGRTAR G++G+SV  +   E
Sbjct: 419 VPSELANYIHRIGRTARSGKEGSSVLFICKDE 450
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 100.0
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.98
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.98
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.98
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.98
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.98
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.97
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.97
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.97
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.97
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.97
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.97
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.97
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.97
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.97
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.96
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.93
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.96
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.96
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.94
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.94
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.93
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.93
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.92
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.92
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.92
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.92
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.92
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.92
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.92
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.92
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.92
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.92
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.92
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.92
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.92
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.91
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.91
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.91
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.91
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.91
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.91
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.9
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.9
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.9
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.89
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.89
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.89
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.88
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.88
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.88
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.88
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.87
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.87
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.86
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.86
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.86
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.85
3h1t_A590 Type I site-specific restriction-modification syst 99.82
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.8
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.78
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.75
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.44
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.12
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.0
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.62
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.35
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.3
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 96.98
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 96.48
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 96.4
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 96.3
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 95.71
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 94.69
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 94.53
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 92.93
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 92.24
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 91.54
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 90.89
3bor_A237 Human initiation factor 4A-II; translation initiat 90.69
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 90.42
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 90.06
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 89.84
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 89.46
2l82_A162 Designed protein OR32; structural genomics, northe 89.45
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 89.21
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 88.46
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 88.39
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 86.26
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 86.15
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 85.96
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 85.64
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 84.97
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 84.05
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 83.41
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 83.02
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 82.92
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 82.7
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 82.49
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 82.31
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 81.97
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 81.39
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 80.73
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 80.47
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 80.38
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=2.2e-35  Score=250.71  Aligned_cols=189  Identities=25%  Similarity=0.407  Sum_probs=165.0

Q ss_pred             CCcceeeeeccccC--CCCCCcEEEEeeecCCChhhhhcccccCCeEEeeeccCCCCCCCCCCCcccccCCCCCcccccc
Q psy9509           5 GVGGLVIMWDTFLT--YPSRPQRLLFSATLSHDPEKLHQLSLFQPKLFTSVVEPAGTGDTQPTSSEAGADNLSSGFIGKF   82 (231)
Q Consensus         5 ~~~~~~~~~~i~~~--~~~~~q~il~SATl~~~~~~~~~~~~~~p~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (231)
                      ++++...+..++..  .+.++|+++||||+|.++..++..++.++..+.+...                          .
T Consensus       217 ~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~--------------------------~  270 (434)
T 2db3_A          217 DMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIV--------------------------G  270 (434)
T ss_dssp             STTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESST--------------------------T
T ss_pred             ccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccc--------------------------c
Confidence            44555555566555  3678999999999999999999999988877665411                          1


Q ss_pred             cCcccccceeeecCCCChHHHHHHHHHhcCCCcEEEEEcchHHHHHHHHHHhhhccccccCCCCcccEEEEcCCCCHHHH
Q psy9509          83 TTPAELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQR  162 (231)
Q Consensus        83 ~~~~~~~~~~~~~~~~~k~~~l~~ll~~~~~~~~iIF~~s~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~h~~~~~~~r  162 (231)
                      ....++.+.+..+....|...|.+++..... ++||||++++.++.+++.|.+.          ++.+..+||++++.+|
T Consensus       271 ~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~-~~lVF~~t~~~a~~l~~~L~~~----------~~~~~~lhg~~~~~~R  339 (434)
T 2db3_A          271 GACSDVKQTIYEVNKYAKRSKLIEILSEQAD-GTIVFVETKRGADFLASFLSEK----------EFPTTSIHGDRLQSQR  339 (434)
T ss_dssp             CCCTTEEEEEEECCGGGHHHHHHHHHHHCCT-TEEEECSSHHHHHHHHHHHHHT----------TCCEEEESTTSCHHHH
T ss_pred             ccccccceEEEEeCcHHHHHHHHHHHHhCCC-CEEEEEeCcHHHHHHHHHHHhC----------CCCEEEEeCCCCHHHH
Confidence            2345677778888888899999999988765 4999999999999999999987          8899999999999999


Q ss_pred             HHHHHHHHcCCccEEEEcCccccccCcCCCcEEEEecCCCCHHHHHHHhcccccCCCCceEEEEeecC
Q psy9509         163 NKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTH  230 (231)
Q Consensus       163 ~~~~~~f~~~~~~vlv~T~~~~~Gidi~~v~~vi~~~~p~~~~~~~qr~GR~gR~g~~g~~~~~~~~~  230 (231)
                      .+++++|++|+.+|||||+++++|+|+|++++||++|.|.+..+|+||+||+||.|+.|.+++|++++
T Consensus       340 ~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~  407 (434)
T 2db3_A          340 EQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPE  407 (434)
T ss_dssp             HHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEECTT
T ss_pred             HHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCCCCCEEEEEEecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999864
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 231
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 6e-21
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-19
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 4e-17
d1gkub2 248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 4e-16
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-15
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 1e-14
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 2e-13
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 1e-12
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-12
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 2e-12
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 8e-11
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 2e-10
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-08
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 3e-08
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 7e-07
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 4e-04
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 6e-04
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 0.002
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 0.002
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 0.003
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 0.003
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 0.003
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 0.004
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]

 Score = 86.9 bits (215), Expect = 6e-21
 Identities = 22/153 (14%), Positives = 45/153 (29%), Gaps = 7/153 (4%)

Query: 80  GKFTTP-AELSEKLTTCSTNLKPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHID- 137
           G  T P   + E   + +  +        +        L F ++ +    LA  L  +  
Sbjct: 2   GSVTVPHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGI 61

Query: 138 NVATKGAGTKMNIAEVYSDLKFDQRNKIIQEFRRRKIDLVVASDNLARG---IDVENIDV 194
           N      G  +++     D+     +  +        D V+  +          ++    
Sbjct: 62  NAVAYYRGLDVSVIPTSGDVVVVATD-ALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFT 120

Query: 195 VINYEAPDNIKKYIHRIGRTARGGRQGTSVTLV 227
           +     P +      R GRT R G+ G    + 
Sbjct: 121 IETTTLPQDAVSRTQRRGRTGR-GKPGIYRFVA 152
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 100.0
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 100.0
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.96
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.96
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.94
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.92
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.91
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.89
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.89
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.88
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.87
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.85
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.77
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.73
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.69
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.67
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.61
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 99.32
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.71
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.51
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 93.5
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 93.23
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 91.27
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 86.79
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 85.25
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 85.02
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 83.47
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 81.02
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.3e-35  Score=217.22  Aligned_cols=138  Identities=27%  Similarity=0.503  Sum_probs=131.2

Q ss_pred             CcccccceeeecCCCC-hHHHHHHHHHhcCCCcEEEEEcchHHHHHHHHHHhhhccccccCCCCcccEEEEcCCCCHHHH
Q psy9509          84 TPAELSEKLTTCSTNL-KPLVLYQLIRKHAMQGVLCFVNTAQGAHRLARLLHHIDNVATKGAGTKMNIAEVYSDLKFDQR  162 (231)
Q Consensus        84 ~~~~~~~~~~~~~~~~-k~~~l~~ll~~~~~~~~iIF~~s~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~h~~~~~~~r  162 (231)
                      +.++++|+|..++.+. |...|.++++...+.++||||+++..++.+++.|+..          +..+..+||++++.+|
T Consensus         4 tl~~i~q~~v~v~~~~~K~~~L~~ll~~~~~~k~iiF~~~~~~~~~~~~~l~~~----------~~~~~~~~~~~~~~~r   73 (168)
T d2j0sa2           4 TLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA----------NFTVSSMHGDMPQKER   73 (168)
T ss_dssp             SCTTEEEEEEEESSTTHHHHHHHHHHHHHTSSEEEEECSSHHHHHHHHHHHHHT----------TCCCEEECTTSCHHHH
T ss_pred             CCCCcEEEEEEecChHHHHHHHHHHHHhCCCCceEEEeeeHHHHHHHHHHhhhc----------ccchhhhhhhhhHHHH
Confidence            4688999999888754 9999999999988889999999999999999999987          8899999999999999


Q ss_pred             HHHHHHHHcCCccEEEEcCccccccCcCCCcEEEEecCCCCHHHHHHHhcccccCCCCceEEEEeecCC
Q psy9509         163 NKIIQEFRRRKIDLVVASDNLARGIDVENIDVVINYEAPDNIKKYIHRIGRTARGGRQGTSVTLVTTHE  231 (231)
Q Consensus       163 ~~~~~~f~~~~~~vlv~T~~~~~Gidi~~v~~vi~~~~p~~~~~~~qr~GR~gR~g~~g~~~~~~~~~~  231 (231)
                      ..++++|+.|+.++||||+++++|+|+|++++|||||+|++...|+||+||+||.|..|.+++|+.+.|
T Consensus        74 ~~~~~~fk~g~~~iLv~Td~~~rGiDi~~v~~VIn~d~P~~~~~yihR~GR~gR~g~~G~~i~~~~~~d  142 (168)
T d2j0sa2          74 ESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDD  142 (168)
T ss_dssp             HHHHHHHHHTSSCEEEECGGGSSSCCCTTEEEEEESSCCSSHHHHHHHHTTSSGGGCCEEEEEEEEGGG
T ss_pred             HHHHHHHhcCCccEEeccchhcccccccCcceEEEecCCcCHHHHHhhhccccccCCCcEEEEEECHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999998764
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure