Diaphorina citri psyllid: psy9513

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490-

MALLDQLHIMGIRNFPADKNRVVRFQRPLTLIVGENGCGKTTIIECIKFALTNEYPQGASSGKNFVHDPRIGKKDEASASSGKNFVHDPRIGKKDETHAIVKLQCTCENNDTVCVVRSLLLSNKNGKDNCATRDTTISRKIFATGVQKNLGCLQQESVLEMCNLIGVSKAILNNVIFCHQENSSWPLDEGKKVKEIFDEIFDATKYNKALESIKIQRDRLRKEIPEIKAHYQATLNYKKEADSKKQLIYNNTQKRDQSFEELHNIEESMKPINEKLVQLTEKERNMSVMSTQYQTKKTERDMIQESCNELESSIKQLFSGDKAELQSKLNLFKINLDEKCSELENQERLKSQYIQEEKQSHTHINEAQMKLGKLERDEETHKKLNDTLKTKLNNLADTLCLDTTAKSQYTPEEGEGLIKMSQTTIDKYLSDIKILERTFSDNENTKQAEINALIVEKVELESKIKSFKQQIEGNKKDLTNVITQINEVNQSQSTLQVLQTKLNRVNSEIDQLSKSLDPDQLKNEIEAWIRQRNELEDELCVIDAEISILQAQNITLAEIKSLKNRKESKLADINLLKERHDRAFHLLFDMIPEENFKNSLDKALSSITFDINRIQEDINAKEKHLYTLEANVSNSSKTLRDQKRTLAELMDRMELVLGSKPFEDELDRVTLELKREQEEVSMMTSTQYLFNSYIGKLEENEPRCPLCTRFFESDYSVPGLVNKLKTKIKEIPEQTNNKKTHIDQLCKQQRSLQELKPVYENIMKLQDTDIPSLRSKLIELEENVIETKGELKKLKTALETPKTKEKTALSLQGDLTLLDQNIRELNTLQRELERQESKISGMRSTGVDLDQVLAQQKEKKNELNTFRSKIESGQTRLNSHNEKLQSLQKQKNDIHSKQLTVQGGAGMLKSLEDRKCELEGMDSVYQTELEELGRKVAPIETQLNLAQSELDALKKEHKKKLNEEGAKIQDYTKQLEEVKRIKLEILNYTKRGTLTQLAALRESVQKLNQRKEDIIAKRGVCERTINEINQSIANQSLEEIDLKNNLTLLEKKEAVAKLNEELKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQLKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQGNDIDYISIAADVGTGSEKRRTYNYRVVQKKNGIEQDMRNRCSAGQRVLACLIIRLFISDQKNFQLIVITHDEEFIENLTAIDRAYVVRIVRDHKALAETFSRNCGIFALDEPTTNLDIKNASDQKNFQLIVITHDEEFIENLTAIDRAYVVRIVRDHKGLSDIHLRSLLSSRLLSRNSKLTLYNTIIKPVLLYGSETWSVTKREEHQMQVFENKVYRTIFGPYFDHQTQSWKRRHNSDIHALSKQPNIVATMNTNRLRWLGHLMRIDKNRAVWKIFTNTPHQGKRLPGRPRSCWINEMKRLCNRWGLNDWEELTQHRVLWRQAVWFSRNSHIPNTPS

cccccccEEccccccccccccEEEcccccEEEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccEEEEEEEEEEEEEcccccHHHccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHcccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccccccEEEEEcccEEEcccccccHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccEEEEEcccHHHHHHHHcccccEEEEEEccccccEEEEEEccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHccccHHHHHcccccHHHHHHcccHHHHHHHHHcccHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccc

*ALLDQLHIMGIRNFPADKNRVVRFQRPLTLIVGENGCGKTTIIECIKFALTNEY***************IGKKDEASASSGKNFVHDPRIGKKDETHAIVKLQCTCENNDTVCVVRSLLLSNKNGKDNCATRDTTISRKIFATGVQKNLGCLQQESVLEMCNLIGVSKAILNNVIFCHQENSSWPLDEGKKVKEIFDEIFDATKYNKALESIKIQRDRLRKEIPEIKAHYQATLNY*******************************************************************************************LNLFKINL*******************************************************LNNLADTLCLDTTA***********LIKMSQTTIDKYLSDIKILERTFSD*****QAEINALIVEKVELESKIKSF*********DLTNVITQIN*************************************EIEAWIRQRNELEDELCVIDAEISILQAQNITLAEIKSLKNRKESKLADINLLKERHDRAFHLLFDMIPEENFKNSLDKALSSITFDINRIQEDINAKEKHLYTL*******************************************************TSTQYLFNSYIGKLEENEPRCPLCTRFFESDYSVPGLVNKLKTKIK*************************LKPVYENIMKLQDTDIPSLRSKLIELEENVI******************************TLL********************************************************************************************************************************************************YTKQLEEVKRIKLEILNYTKRGTLTQLAALRESVQKLNQRKEDIIAKRGVCERTINEINQSIANQSLEEIDLKNNLTLLEKKEAVAKLNEELKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQLKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQGNDIDYISIAADVGTGSEKRRTYNYRVVQKKNGIEQDMRNRCSAGQRVLACLIIRLFISDQKNFQLIVITHDEEFIENLTAIDRAYVVRIVRDHKALAETFSRNCGIFALDEPTTNLDIKNASDQKNFQLIVITHDEEFIENLTAIDRAYVVRIVRDHKGLSDIHLRSLLSSRLLSRNSKLTLYNTIIKPVLLYGSETWSVTKREEHQMQVFENKVYRTIFGPYFDHQTQSWKRRHNSDIHALSKQPNIVATMNTNRLRWLGHLMRIDKNRAVWKIFTNTPHQGKRLPGRPRSCWINEMKRLCNRWGLNDWEELTQHRVLWRQAVWFSRN*HI*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MALLDQLHIMGIRNFPADKNRVVRFQRPLTLIVGENGCGKTTIIECIKFALTNEYPQGASSGKNFVHDPRIGKKDEASASSGKNFVHDPRIGKKDETHAIVKLQCTCENNDTVCVVRSLLLSNKNGKDNCATRDTTISRKIFATGVQKNLGCLQQESVLEMCNLIGVSKAILNNVIFCHQENSSWPLDEGKKVKEIFDEIFDxxxxxxxxxxxxxxxxxxxxxIPEIKAHYQATLNYKKEADSKKQLIYNNTQKRDQSFEELHNIEESMKPINEKLVQLTEKERNMSVMSTQYQTKKTERDMIQESCNELESSIKQLFSGDKAELQSKLNLFKINxxxxxxxxxxxxxxxxxxxxxEKQSHTHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLADTLCLDTTAKSQYTPEEGEGLIKMSQTTIDKYLSDIKILERTFSDNENTKQAExxxxxxxxxxxxxxxxxxxxxxxxxxxxLTNVITQINExxxxxxxxxxxxxxxxxxxxxxxxxxxxLDxxxxxxxxxxxxxxxxxxxxxLCVIDAEISILQAQNITLAExxxxxxxxxxxxxxxxxxxxxHDRAFHLLFDMIPEENFKNSLDKALSSITFDxxxxxxxxxxxxxxxxxxxxxVSNSSKTLRDQKRTLAELMDRMELVLGSKPFEDELDRVTLELKREQEEVSMMTSTQYLFNSYIGKLEENEPRCPLCTRFFESDYSVPGLVNKLKTKIKEIPEQTNNKKTHIDQLCKQQRSLQELKPVYENIMKLQDTDIPSLRSKxxxxxxxxxxxxxxxxxxxxxLETPKTKEKTALSLQGDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGVDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQLTVQGGAGMLKSLEDRKCELEGMDSVYQTELEELGRKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLEILNYTxxxxxxxxxxxxxxxxxxxxxxxxxxxxRGVCERTINEINQSIANQSLEEIDLKNNLTLLEKKEAVAKLNEELKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQLKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQGNDIDYISIAADVGTGSEKRRTYNYRVVQKKNGIEQDMRNRCSAGQRVLACLIIRLFISDQKNFQLIVITHDEEFIENLTAIDRAYVVRIVRDHKALAETFSRNCGIFALDEPTTNLDIKNASDQKNFQLIVITHDEEFIENLTAIDRAYVVRIVRDHKGLSDIHLRSLLSSRLLSRNSKLTLYNTIIKPVLLYGSETWSVTKREEHQMQVFENKVYRTIFGPYFDHQTQSWKRRHNSDIHALSKQPNIVATMNTNRLRWLGHLMRIDKNRAVWKIFTNTPHQGKRLPGRPRSCWINEMKRLCNRWGLNDWEELTQHRVLWRQAVWFSRNSHIPNTPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA repair protein RAD50	Essential component of the MRN complex, a complex that possesses single-stranded DNA endonuclease and 3' to 5' exonuclease activities, and plays a central role in double-strand break (DSB) repair. The complex participates in processes such as DNA recombination, DNA repair, genome stability, telomere integrity and meiosis. The MRN complex may protect telomeres by facilitating recruitment of HOAP and HP1 at chromosome ends. In the complex, it mediates the ATP-binding and is probably required to bind DNA ends and hold them in close proximity.	confident	Q9W252
DNA repair protein RAD50	Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11A. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11A to prevent nucleolytic degradation past a given point. The complex may also be required for DNA damage signaling via activation of the ATM kinase. In telomeres the MRN complex may modulate t-loop formation.	confident	Q92878

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008408 [MF]	3'-5' exonuclease activity	probable	GO:0016787, GO:0004518, GO:0004527, GO:0016788, GO:0003824, GO:0003674
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0033674 [BP]	positive regulation of kinase activity	probable	GO:0042325, GO:0050790, GO:0051347, GO:0019222, GO:0043549, GO:0031323, GO:0051338, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0044093, GO:0019220, GO:0065009, GO:0050789, GO:0043085
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0030870 [CC]	Mre11 complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0030674 [MF]	protein binding, bridging	probable	GO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0045120 [CC]	pronucleus	probable	GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0000794 [CC]	condensed nuclear chromosome	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0016234 [CC]	inclusion body	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000784 [CC]	nuclear chromosome, telomeric region	probable	GO:0031974, GO:0000781, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0007004 [BP]	telomere maintenance via telomerase	probable	GO:0044238, GO:0060249, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0000723, GO:0006139, GO:0044260, GO:0071840, GO:0016043, GO:0071704, GO:0006260, GO:0044699, GO:0065007, GO:0065008, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0044763, GO:0010833, GO:0008152, GO:0046483, GO:0006996, GO:0042592, GO:0006278, GO:0051276, GO:0032200, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0032508 [BP]	DNA duplex unwinding	probable	GO:0071103, GO:0032392, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0006310 [BP]	DNA recombination	probable	GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006302 [BP]	double-strand break repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0031954 [BP]	positive regulation of protein autophosphorylation	probable	GO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0031952, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0051291 [BP]	protein heterooligomerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0000014 [MF]	single-stranded DNA specific endodeoxyribonuclease activity	probable	GO:0016787, GO:0003824, GO:0004536, GO:0004519, GO:0004520, GO:0016788, GO:0004518, GO:0003674
GO:0000019 [BP]	regulation of mitotic recombination	probable	GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0000018, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0050789, GO:0051052

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 241-279
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 29-48
View the alignment between query and template
View the model in PyMOL

Template: 3QF7, chain A
Confidence level:very confident
Coverage over the Query: 2-71,92-203
View the alignment between query and template
View the model in PyMOL

Template: 3QKS, chain A
Confidence level:confident
Coverage over the Query: 2-79,93-236
View the alignment between query and template
View the model in PyMOL

Template: 1OXX, chain K
Confidence level:confident
Coverage over the Query: 1172-1202,1213-1310
View the alignment between query and template
View the model in PyMOL

Template: 1JI0, chain A
Confidence level:confident
Coverage over the Query: 2-101
View the alignment between query and template
View the model in PyMOL

Template: 1GXL, chain A
Confidence level:probable
Coverage over the Query: 555-707
View the alignment between query and template
View the model in PyMOL

Template: 3KTA, chain B
Confidence level:probable
Coverage over the Query: 1136-1199,1245-1319
View the alignment between query and template
View the model in PyMOL

Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 811-881
View the alignment between query and template
View the model in PyMOL

Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 876-944
View the alignment between query and template
View the model in PyMOL

Template: 1L8D, chain A
Confidence level:probable
Coverage over the Query: 667-749
View the alignment between query and template
View the model in PyMOL

Template: 2FXO, chain A
Confidence level:probable
Coverage over the Query: 343-395
View the alignment between query and template
View the model in PyMOL

Template: 2XS1, chain A
Confidence level:probable
Coverage over the Query: 744-1018
View the alignment between query and template
View the model in PyMOL