Psyllid ID: psy9513
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1491 | 2.2.26 [Sep-21-2011] | |||||||
| Q9W252 | 1318 | DNA repair protein RAD50 | yes | N/A | 0.818 | 0.925 | 0.286 | 1e-125 | |
| Q92878 | 1312 | DNA repair protein RAD50 | yes | N/A | 0.831 | 0.945 | 0.272 | 1e-120 | |
| P70388 | 1312 | DNA repair protein RAD50 | yes | N/A | 0.796 | 0.904 | 0.267 | 1e-116 | |
| Q9JIL8 | 1312 | DNA repair protein RAD50 | yes | N/A | 0.790 | 0.898 | 0.263 | 1e-112 | |
| P12753 | 1312 | DNA repair protein RAD50 | yes | N/A | 0.773 | 0.878 | 0.253 | 1e-75 | |
| Q9SL02 | 1316 | DNA repair protein RAD50 | yes | N/A | 0.129 | 0.146 | 0.418 | 1e-36 | |
| Q54CS9 | 1351 | DNA repair protein RAD50 | yes | N/A | 0.370 | 0.408 | 0.253 | 1e-34 | |
| C6KSQ6 | 2236 | Probable DNA repair prote | yes | N/A | 0.107 | 0.071 | 0.373 | 5e-32 | |
| Q8SRK6 | 1247 | DNA repair protein RAD50 | yes | N/A | 0.128 | 0.153 | 0.359 | 7e-30 | |
| Q9UTJ8 | 1285 | DNA repair protein rad50 | yes | N/A | 0.084 | 0.098 | 0.406 | 6e-24 |
| >sp|Q9W252|RAD50_DROME DNA repair protein RAD50 OS=Drosophila melanogaster GN=rad50 PE=2 SV=4 | Back alignment and function desciption |
|---|
Score = 452 bits (1162), Expect = e-125, Method: Compositional matrix adjust.
Identities = 392/1366 (28%), Positives = 677/1366 (49%), Gaps = 146/1366 (10%)
Query: 1 MALLDQLHIMGIRNFP--ADKNRVVRFQRPLTLIVGENGCGKTTIIECIKFALTNEYPQG 58
M+ ++ L I GIR+F AD + ++F P+TLI+GENGCGKTT++EC+K+ALT E P G
Sbjct: 1 MSSIESLSIQGIRSFGTYADDLQSIKFSSPVTLILGENGCGKTTVVECLKYALTGECPPG 60
Query: 59 ASSGKNFVHDPRIGKKDEASASSGKNFVHDPRIGKKDETHAIVKLQCTCENNDTVCVVRS 118
+ GK+FVH DP+I +E A +K+Q V + R+
Sbjct: 61 SDRGKSFVH--------------------DPKIFGLNEVLAQIKMQVRDRRGAQVSICRT 100
Query: 119 LLLSNKNGKDNCATRDTTISRKIFATGV-------QKNLGCLQQESVLEMCNLIGVSKAI 171
+ +S K K + T D+TI+ F TG Q +L + + + + +GVSKAI
Sbjct: 101 MKVSKKRNKMSFETMDSTIN---FLTGAGQSKREKQDSLSGRSVDIDVAISDFMGVSKAI 157
Query: 172 LNNVIFCHQENSSWPLDEGKKVKEIFDEIFDATKYNKALESIKIQRDRLRKEIPEIKAHY 231
+NNV+FCHQE+SSWPLDE KK+KE FD IF T+YNKAL+ I R +E+ +A+
Sbjct: 158 INNVLFCHQEDSSWPLDESKKLKEKFDAIFGITEYNKALDKIIKLRKEAMEELKIKEANI 217
Query: 232 QATLNYKKEADSKKQLIYNNTQKRDQSFEELHNIEESMKPINEKLVQLTEKERNMSVMST 291
+ K+E + K + +K D + EE MKPI +LV++ RN+
Sbjct: 218 KHVAYLKQEMEVKTLNLQKAQRKCDAIKAQCSECEEEMKPIEARLVEI----RNVEFEIG 273
Query: 292 QYQTKKTERDMIQESCNE----LESSIKQLFSGDKAELQSKLNLFK---INLDEKCSELE 344
+YQ +K E D ++C + L IK+ F G EL +++ F + + +K +E+E
Sbjct: 274 KYQAQKVEMDTKHKNCKDQISTLTLKIKKPFRGTLDELDQEISNFDQRMLEMRQKRTEVE 333
Query: 345 N------------QERLKSQYIQEEKQSHTHINEAQMKLGKLERDEETHKKLNDTLKTKL 392
QE+L +Q + H +E + L+R +E ++L+
Sbjct: 334 GDLSQIKRSSVAEQEKLGTQDRKHCLAKQRHQSELACRAQLLKRVKEFCRELH------- 386
Query: 393 NNLADTLCLDTTAKSQYTPEE-GEGLIKMSQTTIDKYLSDIKILERTFSDNENTKQAEIN 451
+ +D Q PE+ GE L + I K+ +I+E+ + ++Q +I+
Sbjct: 387 ------IPIDCDLVEQ--PEKMGEVLRDIEAMIITKHCEITEIVEQN-EKADRSRQVKID 437
Query: 452 ALIVEKVELESKIKSFKQQIEGNKKDLTNVITQINEVNQSQSTLQVLQTKLNRVNSEIDQ 511
L +E + E + + ++Q E +K++ + +I ++ S L+ L+ ++N VN +
Sbjct: 438 ELRIELTKSEQSVTAQEKQRESSKRESETLGVEIKKIETSMQDLKKLEKEINEVNELYES 497
Query: 512 LSKSLDPDQLKNEIEAWIRQRNELEDELCVIDAEISILQAQNITLAEIKSLKNRK-ESKL 570
+K++D +K+ I E + + +D +++ L + +AE SLK ++ + K
Sbjct: 498 ATKNIDQQAIKDAIARKKASIAENQIQFKKLDEQLTFLGSMAKLVAEC-SLKQKELDKKN 556
Query: 571 ADINLLKERHDRAFHLLFDMIPEENFKNSLDKALSSITFDINRIQEDINAKEKHLYTLEA 630
+++ ++ RH F LF N++ S+ + +I + E N ++ + E
Sbjct: 557 QEVHRVRSRHSDHFGKLFKEPITCNYRRSMQVVYEKLRREIQELNEKANTQKLKEQSYEI 616
Query: 631 NVSNSSKTLRDQKRTLAELMDRMELVLG---SKPFEDELDRVTLELKREQEEVSMMTSTQ 687
N + D R EL D EL+ S P++D L+R + + Q + + S++
Sbjct: 617 KRKN---LISDISRMEKELKDSEELIYQKCRSTPYDDLLERSKTTISKLQFDHGALKSSE 673
Query: 688 YLFNSYIGKLEENEPRCPLCTRFFESDYSVPGLVNKLKTKIKEIPEQTNNKKTHIDQLCK 747
L+ YI K++E EP CPLC SD + L ++L +I+++P+ + +
Sbjct: 674 ALYKKYIQKMDE-EPSCPLCHHNMTSDEAC-DLTSELTDEIQKLPDNITRAEKALKAEQI 731
Query: 748 QQRSLQELKPVYENIMKLQDTDIPSLRSKLIELEENVIETKGELKKLKTALETPKTKEKT 807
+ +L +LKP + +L+D+ +P + +L ++EE + ++ E + L + P +
Sbjct: 732 KYENLLQLKPTILKVKELKDS-LPQKKEELKKVEELLGDSVSEYETLIALIGEPTHNMEL 790
Query: 808 ALSLQGDLTLLDQNIRELNTLQRELERQESKISGMRSTGVDLDQVLAQQKEKKNELNTFR 867
A S+ GD++LLD+ +++ L ++L+ Q+ ++ + V +D + A++ + EL T R
Sbjct: 791 ANSMMGDMSLLDEALKDSARLTKDLDLQKGQLPASYDSSVSMDDLQAEKSKVSKELETER 850
Query: 868 SKIESGQTRLNSHNEKLQSLQKQKNDIHSKQLTVQGGAGMLKSLEDRKCELEGMDSVYQT 927
++ES Q + + L L+++KN + +Q+ ++ G L L++R +L + +
Sbjct: 851 KELESAQNAVQQQMDALNRLREKKNSLKDRQIHLREGLQSLPQLKERLEKLNSFLTTVAS 910
Query: 928 ELEELGRKVAPIETQLNLAQSELDALKKEHKKKLNEEGAKIQDYTKQLEEVKRIKLEILN 987
E+ EL K+ P++ L A E + LKK +KL + +K Y +++R+ E +
Sbjct: 911 EISELKAKIQPLKLNLRAAIEEKERLKKSESEKLAQLNSKYNSYKSTDHDIQRLNKEAED 970
Query: 988 YTKRGTLTQLAALRESVQKLNQRKEDIIAKRGVCERTINEINQSIANQSLEEIDLKNNLT 1047
Y K ++ L E + + + A+ + + I +NQ E DLK+N
Sbjct: 971 YAKLDLRNEIKKLDEIIMASKDKLRKLEAEISLKTDELETIKTECSNQQTVERDLKDNRE 1030
Query: 1048 LLEKKEAVAKLNEELKLSEIMISDLTKYHHTLENCVI-------------------KYHS 1088
L + ++ AKL E ++ + + +L + + E + + HS
Sbjct: 1031 LKQLEDKEAKLRESCQVLDKQLGNLDFHSVSKEKVNLTKQRDKATVRKGELLGQLGEIHS 1090
Query: 1089 QKMRSINRLIRE------------YWTRIYQLKLSEIMISDLTKYHHTLENCVIKYHSQK 1136
Q +N+L RE + Y+++++ + I DL +Y LE +I++HS+K
Sbjct: 1091 Q----VNKLQREIDEPRFKESLKNFRKANYEIEVTRLCIEDLGQYRLALEWALIQFHSEK 1146
Query: 1137 MRSINRLIREYWTRIYQGNDIDYISIAAD---VGTGSEKRRTYNYRVVQKKNGIEQDMRN 1193
M INRLIREYW +IY+GNDIDYI + D +++R+TYNYRVVQ KN E +MR
Sbjct: 1147 MEMINRLIREYWRKIYRGNDIDYIQVKTDEVSSDASADRRKTYNYRVVQSKNYSEIEMRG 1206
Query: 1194 RCSAGQRVLACLIIRLFISDQKNFQLIVITHDEEFIENLTAIDRAYVVRIVRDHKALAET 1253
RCSAGQRVLA LIIRL +++ + V+ DE T +DRA + +L E
Sbjct: 1207 RCSAGQRVLASLIIRLALAETFSSNCGVLALDEP----TTNLDRANI-------NSLCEA 1255
Query: 1254 FSRNCGIFALDEPTTNLDIKNASDQKNFQLIVITHDEEFIENLTAI 1299
NC ++ Q NF LI+ITHDE F+ +L I
Sbjct: 1256 L--NCI------------VEERQSQSNFMLIIITHDENFVSSLGKI 1287
|
Essential component of the MRN complex, a complex that possesses single-stranded DNA endonuclease and 3' to 5' exonuclease activities, and plays a central role in double-strand break (DSB) repair. The complex participates in processes such as DNA recombination, DNA repair, genome stability, telomere integrity and meiosis. The MRN complex may protect telomeres by facilitating recruitment of HOAP and HP1 at chromosome ends. In the complex, it mediates the ATP-binding and is probably required to bind DNA ends and hold them in close proximity. Drosophila melanogaster (taxid: 7227) EC: 3EC: .EC: 6EC: .EC: -EC: .EC: - |
| >sp|Q92878|RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens GN=RAD50 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P70388|RAD50_MOUSE DNA repair protein RAD50 OS=Mus musculus GN=Rad50 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9JIL8|RAD50_RAT DNA repair protein RAD50 OS=Rattus norvegicus GN=Rad50 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P12753|RAD50_YEAST DNA repair protein RAD50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD50 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SL02|RAD50_ARATH DNA repair protein RAD50 OS=Arabidopsis thaliana GN=RAD50 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q54CS9|RAD50_DICDI DNA repair protein RAD50 OS=Dictyostelium discoideum GN=rad50 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|C6KSQ6|RAD50_PLAF7 Probable DNA repair protein RAD50 OS=Plasmodium falciparum (isolate 3D7) GN=PFF0285c PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8SRK6|RAD50_ENCCU DNA repair protein RAD50 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RAD50 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UTJ8|RAD50_SCHPO DNA repair protein rad50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad50 PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1491 | ||||||
| 328713323 | 1303 | PREDICTED: DNA repair protein RAD50-like | 0.841 | 0.963 | 0.287 | 1e-129 | |
| 238637251 | 1312 | RAD50 homolog [Xenopus laevis] gi|224555 | 0.794 | 0.903 | 0.274 | 1e-126 | |
| 28317081 | 1322 | LP09268p, partial [Drosophila melanogast | 0.818 | 0.922 | 0.286 | 1e-124 | |
| 281364022 | 1318 | rad50, isoform D [Drosophila melanogaste | 0.818 | 0.925 | 0.286 | 1e-124 | |
| 386768435 | 1318 | rad50, isoform E [Drosophila melanogaste | 0.818 | 0.925 | 0.286 | 1e-123 | |
| 307184041 | 1368 | DNA repair protein RAD50 [Camponotus flo | 0.823 | 0.897 | 0.275 | 1e-123 | |
| 195488694 | 1303 | GE14184 [Drosophila yakuba] gi|194178523 | 0.809 | 0.926 | 0.288 | 1e-123 | |
| 269914207 | 1322 | FI13085p [Drosophila melanogaster] | 0.818 | 0.922 | 0.286 | 1e-123 | |
| 195346724 | 1303 | GM15911 [Drosophila sechellia] gi|194135 | 0.813 | 0.930 | 0.290 | 1e-123 | |
| 301620437 | 1269 | PREDICTED: DNA repair protein RAD50 [Xen | 0.765 | 0.899 | 0.276 | 1e-123 |
| >gi|328713323|ref|XP_001948559.2| PREDICTED: DNA repair protein RAD50-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 469 bits (1207), Expect = e-129, Method: Compositional matrix adjust.
Identities = 389/1352 (28%), Positives = 695/1352 (51%), Gaps = 97/1352 (7%)
Query: 1 MALLDQLHIMGIRNFPADKNRVVRFQRPLTLIVGENGCGKTTIIECIKFALTNEYPQGAS 60
M+ L+ + I GIR++ D+ + ++F +PLTLI+G+NGCGKTTIIEC+K+ ++ P+ A+
Sbjct: 1 MSTLESISIQGIRSYHPDEKQTLKFYKPLTLILGQNGCGKTTIIECLKYITCSDLPRNAN 60
Query: 61 SGKNFVHDPRIGKKDEASASSGKNFVHDPRIGKKDETHAIVKLQCTCENNDTVCVVRSLL 120
G FV DP++ VKL + V V ++L
Sbjct: 61 KG---------------------GFVWDPKLSDHHTVKGNVKLSFHDTKDTRVVVSKTLE 99
Query: 121 LSNKNGKDNCATRDTTISRKIFATGVQKNLGCLQQESVLEMCNLIGVSKAILNNVIFCHQ 180
+ K + + D TISRK G + C + V MC +GVSK+IL +V+FCHQ
Sbjct: 100 STQKLATVSTKSLDQTISRK----GQSTSHKCADLDDV--MCTYLGVSKSILKDVVFCHQ 153
Query: 181 ENSSWPLDEGKKVKEIFDEIFDATKYNKALESIKIQRDRLRKEIPEIKAHYQATLNYKKE 240
E+S+WPLDE KKVKE FD IFD KY+K ++ I+I+ + + + Q Y++E
Sbjct: 154 EDSNWPLDEDKKVKEKFDSIFDVGKYDKCIKQIQIEIKATQADKRTCNNNIQHFWKYREE 213
Query: 241 ADSKKQLIYNNTQKRDQSFEELHNIEESMKPINEKLVQLTEKERNMSVMSTQYQTKKTER 300
A +K+ + N D+ ++L++I++ + P+ E+ ++ +KE + + + T +
Sbjct: 214 ARNKRATLENKKFSFDELQQKLNSIDKEIIPLEERYKEIMKKEEHFFSLKNKLLTSEGNL 273
Query: 301 DMIQESCNELESSIKQLFSGDKAELQSKLNLFKINLDEKCSELENQERLKSQYIQEEKQS 360
+ I+ + +L+ IK F G+ ++L +L F NL +K + LK+ I E +
Sbjct: 274 NSIRLAIKDLKLLIKLEFKGNDSDLDEELKNFNNNLVQKEKDKYKLNCLKNDAITNENKI 333
Query: 361 HTHINEAQMKLGKLERDEETHKKLNDTLK--TKLNNLADTLCLDTTAKSQYTPEEGEGLI 418
++++ Q+ LG+ + +E+ + LN+ K K+ L + + + ++Y + +
Sbjct: 334 QENMSKEQVNLGRYQSEEKQN--LNNINKQNAKIIELGNEMQFNLPDLTEYNRVQVISNL 391
Query: 419 KMSQTTIDKYLSDIKILERTFSDNENTKQAEINALIVEKVELESKIKSFKQQIEGNKKDL 478
+ ++++ L + R EN Q+ I+++ VEK +L+ +IK ++QI N ++
Sbjct: 392 SNNLSSMNDKLESTQKEHREI---ENKLQSNIDSIRVEKAKLDQEIKIKEKQILENTSEI 448
Query: 479 TNVITQINEVNQSQSTLQVLQTKLNRVNSEIDQLSKSLDPDQLKNEIEAWIRQRNELEDE 538
+ I++V S L LQ + ++++ L SL+ D +K +I ++ E +
Sbjct: 449 QKLKKDIDQVRNSAEKLSALQKSKVDIETKLNILRGSLNVDDVKKDINKKKDEKYEQNIK 508
Query: 539 LCVIDAEISILQAQNITLAEIKSLKNRKESKLADINLLKERHDRAFHLLFDMIPEENFKN 598
L VI+ E+ LQ +I AE+ ++ K + +LK + + L IP+E K
Sbjct: 509 LEVIEKEVQKLQLLSIVQAELDTVILNKTGIDNKLKILKNKVNDVLKDLLGFIPQEKLKF 568
Query: 599 SLDKALSSITFDINRIQEDINAKEKHLYTLEANVSNSSKTLRDQKRTLAELMDRMELVLG 658
L ++ I ++ I K+K L TLEAN +++ + LR ++ L+ + + +
Sbjct: 569 EFTSFLDKLSDTIRCNRKSIAEKQKQLTTLEANYNHTKEKLRTKQIELSNDENALSDMCQ 628
Query: 659 SKPFEDELDRVTLELKREQEEVSMMTSTQYLFNSYIGKLEENEPRCPLCTRFFESDYSVP 718
+ +E L V +++ Q + ++++ +LF YI LE +P CPLC R F S V
Sbjct: 629 GQEYETILKEVNEKVEELQAQKGSVSTSGHLFRRYIKNLEAQDPSCPLCHRCFGSIDEVT 688
Query: 719 GLVNKLKTKIKEIPEQTNNKKTHIDQLCKQQRSLQELKPVYENIMKLQDTDIPSLRSKLI 778
L+N L ++ +IP + ++ L K+Q LQ+L+P Y I L+ T+IP+L+ +L
Sbjct: 689 ELINDLNMRVHKIPSELETTIAQLETLLKKQSKLQQLRPTYTRISVLKQTEIPNLKDELE 748
Query: 779 ELEENVIETKGELKKLKTALETPKTKEKTALSLQGDLTLLDQNIRELNTLQRELERQESK 838
+ N+ + + EL KL +T E A ++Q D+ ++D ++ +E +R +K
Sbjct: 749 RISSNLRKCRDELTKLSDENGKLETNETNAKNIQSDIIMIDSFDNDVKRYSKEEQRLTTK 808
Query: 839 ISGMRSTGVDLDQVLAQQKEKKNELNTFRSKIESGQTRLNSHNEKLQSLQKQKNDIHSKQ 898
++ S +L + ++++ K+ +N + +E Q LN + E L +LQ Q+N I S +
Sbjct: 809 MTESGSIR-NLQEAISERNALKSTINEICNVLEKKQYELNEYTEMLHNLQTQQNKITSDE 867
Query: 899 LTVQGGAGMLKSLEDRKCELEGMDSVYQTELEELGRKVAPIETQLNLAQSELDALKKEHK 958
L ++ KS+ D+ +L+ +++ EL+ + PI+ +L+ + + KK+
Sbjct: 868 LNIKSKMQDEKSVIDKLNDLQNLEATISLELDSARETLGPIQEKLDTCINTFEQTKKQQS 927
Query: 959 KKLNEEGAKIQDYTKQLEEVKRIKLEILNYTKRGTLTQLAALRESVQKLNQRKEDIIAKR 1018
+K+ +I K+++E+ ++ I NY K+ ++ + LN+ K + I ++
Sbjct: 928 RKIENNRKEIIILEKKIQEINNLQSSIDNYEKKEWTLRIKETNNLLNNLNKEKMNYIEEQ 987
Query: 1019 GVCERTINEINQSIANQSLEEIDLKNNLTLLEK-KEAVAKLNEELKLSE----IMISDL- 1072
++ I+ IN+ ANQ +++IDL+NN L +K KE + L+E K E + ++ L
Sbjct: 988 KNLQKQIDSINEYNANQEVKKIDLENNKKLRQKSKEEIECLSEINKFHEDFGTMDVNSLL 1047
Query: 1073 ------TKYHHTL--ENCVIKYHSQKMRSINRLIREYWTRIY-------------QLKLS 1111
TK L E Q++ +I R I E T I+ QL++
Sbjct: 1048 SEKSTNTKQRQALAEEKNKSLGRKQELDNIIRHITEELTAIHFKNAENIYLHEKVQLEIL 1107
Query: 1112 EIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQGNDIDYISIAAD-----V 1166
+ DLTKY+ LE + ++H ++M+SIN +I++ W IY GNDIDYI I +
Sbjct: 1108 NRVEKDLTKYNKALEWAMNRFHKERMQSINTIIKKLWRDIYTGNDIDYIQIKTSSDDKPI 1167
Query: 1167 GTGSEKRRTYNYRVVQKKNGIEQDMRNRCSAGQRVLACLIIRLFISDQKNFQLIVITHDE 1226
T + K+R +NYRVVQ KN +E DMR RCSAGQ+VLACLI+R+ +++ + ++ DE
Sbjct: 1168 QTDTIKKRVFNYRVVQIKNEVELDMRGRCSAGQKVLACLIVRMALAETFSKNCGILALDE 1227
Query: 1227 EFIENLTAIDRAYVVRIVRDHKALAETFSRNCGIFALDEPTTNLDIKNASDQKNFQLIVI 1286
T +D + + ++LAE+ S I S QK+FQL++I
Sbjct: 1228 P----TTNLDESNI-------QSLAESLSE--------------IITRRSSQKSFQLLII 1262
Query: 1287 THDEEFIENLTA---IDRAYVVRIVRDHKGLS 1315
THD F+ L+A +D Y V+ R ++G+S
Sbjct: 1263 THDPNFLRKLSARDMVDTYYEVK--RSNEGMS 1292
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|238637251|ref|NP_001154855.1| RAD50 homolog [Xenopus laevis] gi|224555762|gb|ACN56470.1| Rad50 [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|28317081|gb|AAO39559.1| LP09268p, partial [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|281364022|ref|NP_726199.3| rad50, isoform D [Drosophila melanogaster] gi|384872701|sp|Q9W252.4|RAD50_DROME RecName: Full=DNA repair protein RAD50 gi|272432636|gb|AAF46847.3| rad50, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|386768435|ref|NP_001246461.1| rad50, isoform E [Drosophila melanogaster] gi|383302640|gb|AFH08214.1| rad50, isoform E [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|307184041|gb|EFN70591.1| DNA repair protein RAD50 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|195488694|ref|XP_002092422.1| GE14184 [Drosophila yakuba] gi|194178523|gb|EDW92134.1| GE14184 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|269914207|gb|ACZ52623.1| FI13085p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195346724|ref|XP_002039907.1| GM15911 [Drosophila sechellia] gi|194135256|gb|EDW56772.1| GM15911 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|301620437|ref|XP_002939584.1| PREDICTED: DNA repair protein RAD50 [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1491 | ||||||
| FB|FBgn0034728 | 1318 | rad50 "rad50" [Drosophila mela | 0.837 | 0.946 | 0.268 | 6.6e-113 | |
| UNIPROTKB|Q92878 | 1312 | RAD50 "DNA repair protein RAD5 | 0.820 | 0.932 | 0.247 | 5.3e-104 | |
| UNIPROTKB|E2QT24 | 1314 | RAD50 "Uncharacterized protein | 0.821 | 0.932 | 0.243 | 1.1e-101 | |
| UNIPROTKB|F6UTT0 | 1312 | RAD50 "Uncharacterized protein | 0.821 | 0.933 | 0.242 | 1.5e-101 | |
| UNIPROTKB|G3X6W2 | 1312 | RAD50 "Uncharacterized protein | 0.821 | 0.933 | 0.244 | 5.7e-101 | |
| ZFIN|ZDB-GENE-050506-110 | 1312 | rad50 "RAD50 homolog (S. cerev | 0.651 | 0.740 | 0.232 | 4.1e-99 | |
| MGI|MGI:109292 | 1312 | Rad50 "RAD50 homolog (S. cerev | 0.817 | 0.929 | 0.243 | 1.1e-98 | |
| UNIPROTKB|F1NEG1 | 1315 | RAD50 "Uncharacterized protein | 0.804 | 0.912 | 0.252 | 2.3e-98 | |
| RGD|621542 | 1312 | Rad50 "RAD50 homolog (S. cerev | 0.818 | 0.930 | 0.240 | 9.1e-96 | |
| UNIPROTKB|Q9JIL8 | 1312 | Rad50 "DNA repair protein RAD5 | 0.818 | 0.930 | 0.240 | 9.1e-96 |
| FB|FBgn0034728 rad50 "rad50" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1114 (397.2 bits), Expect = 6.6e-113, P = 6.6e-113
Identities = 366/1362 (26%), Positives = 638/1362 (46%)
Query: 1 MALLDQLHIMGIRNFP--ADKNRVVRFQRPLTLIVGENGCGKTTIIECIKFALTNEYPQG 58
M+ ++ L I GIR+F AD + ++F P+TLI+GENGCGKTT++EC+K+ALT E P G
Sbjct: 1 MSSIESLSIQGIRSFGTYADDLQSIKFSSPVTLILGENGCGKTTVVECLKYALTGECPPG 60
Query: 59 ASSGKNFVHDPRIGKKDEASASSGKNFVHDPRIGKKDETHAIVKLQCTCENNDTVCVVRS 118
+ GK+FVHDP+I G N E A +K+Q V + R+
Sbjct: 61 SDRGKSFVHDPKI---------FGLN-----------EVLAQIKMQVRDRRGAQVSICRT 100
Query: 119 LLLSNKNGKDNCATRDTTISRKIFATGV----QKNLGCLQQESV---LEMCNLIGVSKAI 171
+ +S K K + T D+TI+ F TG ++ L SV + + + +GVSKAI
Sbjct: 101 MKVSKKRNKMSFETMDSTIN---FLTGAGQSKREKQDSLSGRSVDIDVAISDFMGVSKAI 157
Query: 172 LNNVIFCHQENSSWPLDEGKKVKEIFDEIFDATKYNKALESI-KIQRDRLRK-EIPEIKA 229
+NNV+FCHQE+SSWPLDE KK+KE FD IF T+YNKAL+ I K++++ + + +I E
Sbjct: 158 INNVLFCHQEDSSWPLDESKKLKEKFDAIFGITEYNKALDKIIKLRKEAMEELKIKEANI 217
Query: 230 HYQATLNYKKEADSKKQLIYNNTQKRDQSFEELHNIEESMKPINEKLVQLTEKERNMSVM 289
+ A L K+E + K + +K D + EE MKPI +LV++ RN+
Sbjct: 218 KHVAYL--KQEMEVKTLNLQKAQRKCDAIKAQCSECEEEMKPIEARLVEI----RNVEFE 271
Query: 290 STQYQTKKTERDMIQESCNE----LESSIKQLFSGDKAELQSKLNLFK---INLDEKCSE 342
+YQ +K E D ++C + L IK+ F G EL +++ F + + +K +E
Sbjct: 272 IGKYQAQKVEMDTKHKNCKDQISTLTLKIKKPFRGTLDELDQEISNFDQRMLEMRQKRTE 331
Query: 343 LENQ-ERLKSQYIQEEKQSHTHINEAQMKLGKLERDEEXXXXXXXXXXXXXXXXADTLCL 401
+E ++K + E+++ T + + L K E + +
Sbjct: 332 VEGDLSQIKRSSVAEQEKLGTQ--DRKHCLAKQRHQSELACRAQLLKRVKEFCRELHIPI 389
Query: 402 DTTAKSQYTPEE-GEGLIKMSQTTIDKYLSDIKILERTFSDNENTKQAEINALIVEKVEL 460
D Q PE+ GE L + I K+ +I+E+ + ++Q +I+ L +E +
Sbjct: 390 DCDLVEQ--PEKMGEVLRDIEAMIITKHCEITEIVEQN-EKADRSRQVKIDELRIELTKS 446
Query: 461 ESKIKSFKQQIEGNKKDLTNVITQINEVNQSQSTLQVLQTKLNRVNSEIDQLSKSLDPDQ 520
E + + ++Q E +K++ + +I ++ S L+ L+ ++N VN + +K++D
Sbjct: 447 EQSVTAQEKQRESSKRESETLGVEIKKIETSMQDLKKLEKEINEVNELYESATKNIDQQA 506
Query: 521 LKNEIEAWIRQRNELEDELCVIDAEISILQAQNITLAEIKSLKNRK-ESKLADINLLKER 579
+K+ I E + + +D +++ L + +AE SLK ++ + K +++ ++ R
Sbjct: 507 IKDAIARKKASIAENQIQFKKLDEQLTFLGSMAKLVAEC-SLKQKELDKKNQEVHRVRSR 565
Query: 580 HDRAFHLLFDMIPEENFKNSLDKALSSITFDINRIQEDINAKEKHLYTLEANVSNSSKTL 639
H F LF N++ S+ + +I + E N ++ + E N +
Sbjct: 566 HSDHFGKLFKEPITCNYRRSMQVVYEKLRREIQELNEKANTQKLKEQSYEIKRKN---LI 622
Query: 640 RDQKRTLAELMDRMELVLG---SKPFEDELDRVTLELKREQEEVSMMTSTQYLFNSYIGK 696
D R EL D EL+ S P++D L+R + + Q + + S++ L+ YI K
Sbjct: 623 SDISRMEKELKDSEELIYQKCRSTPYDDLLERSKTTISKLQFDHGALKSSEALYKKYIQK 682
Query: 697 LEENEPRCPLCTRFFESDYSVPGLVNKLKTKIKEIPEQ-TNNKKTHIDQLCKQQRSLQEL 755
++E EP CPLC SD + L ++L +I+++P+ T +K + K + LQ L
Sbjct: 683 MDE-EPSCPLCHHNMTSDEACD-LTSELTDEIQKLPDNITRAEKALKAEQIKYENLLQ-L 739
Query: 756 KPVYENIMKLQDTDIPSLRSKLIELEENVIETKGELKKLKTALETPKTKEKTALSLQGDL 815
KP + +L+D+ +P + +L ++EE + ++ E + L + P + A S+ GD+
Sbjct: 740 KPTILKVKELKDS-LPQKKEELKKVEELLGDSVSEYETLIALIGEPTHNMELANSMMGDM 798
Query: 816 TLLDQNIRELNTLQRELERQESKISGMRSTGVDLDQVLAQQKEKKNELNTFRSKIESGQT 875
+LLD+ +++ L ++L+ Q+ ++ + V +D + A++ + EL T R ++ES Q
Sbjct: 799 SLLDEALKDSARLTKDLDLQKGQLPASYDSSVSMDDLQAEKSKVSKELETERKELESAQN 858
Query: 876 RLNSHNEKLQSLQKQKNDIHSKQLTVQGGAGMLKSLEDRKCELEGMDSVYQTELEELGRK 935
+ + L L+++KN + +Q+ ++ G L L++R +L + +E+ EL K
Sbjct: 859 AVQQQMDALNRLREKKNSLKDRQIHLREGLQSLPQLKERLEKLNSFLTTVASEISELKAK 918
Query: 936 VAPIETQLNLAQSXXXXXXXXXXXXXXXXGAKIQDYTKQLEEVKRIKLEILNYTKRGTLT 995
+ P++ L A +K Y +++R+ E +Y K
Sbjct: 919 IQPLKLNLRAAIEEKERLKKSESEKLAQLNSKYNSYKSTDHDIQRLNKEAEDYAKLDLRN 978
Query: 996 QLAALRESVQKLNQRKEDIIAKRGVCERTINEINQSIANQSLEEIDXXXXXXXXXXXXAV 1055
++ L E + + + A+ + + I +NQ E D
Sbjct: 979 EIKKLDEIIMASKDKLRKLEAEISLKTDELETIKTECSNQQTVERDLKDNRELKQLEDKE 1038
Query: 1056 AKLNEELKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQLKLSEIMI 1115
AKL E ++ + + +L +H + K + K R +R+ + QL EI
Sbjct: 1039 AKLRESCQVLDKQLGNLD-FHSVSKE---KVNLTKQRD-KATVRK-GELLGQL--GEIH- 1089
Query: 1116 SDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQGNDIDYISIAAD---VGTGSEK 1172
S + K ++ K + R N I TR+ D+ +A + + SEK
Sbjct: 1090 SQVNKLQREIDEPRFKESLKNFRKANYEIEV--TRLCI-EDLGQYRLALEWALIQFHSEK 1146
Query: 1173 RRTYN------YRVVQKKNGIE--QDMRNRCSAGQRVLACLIIRLFISDQKNFQLIVITH 1224
N +R + + N I+ Q + S+ + KN+ I
Sbjct: 1147 MEMINRLIREYWRKIYRGNDIDYIQVKTDEVSSDASADRRKTYNYRVVQSKNYSEI---- 1202
Query: 1225 DEEFIENLTAIDRAYVVRIVRDHKALAETFSRNCGIFALDEPTTNLD------------- 1271
E +A R I+R ALAETFS NCG+ ALDEPTTNLD
Sbjct: 1203 --EMRGRCSAGQRVLASLIIR--LALAETFSSNCGVLALDEPTTNLDRANINSLCEALNC 1258
Query: 1272 -IKNASDQKNFQLIVITHDEEFIENLTAIDRAYVVRIVRDHK 1312
++ Q NF LI+ITHDE F+ +L I + R+ R+ +
Sbjct: 1259 IVEERQSQSNFMLIIITHDENFVSSLGKITSYH--RVFRNEE 1298
|
|
| UNIPROTKB|Q92878 RAD50 "DNA repair protein RAD50" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QT24 RAD50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6UTT0 RAD50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X6W2 RAD50 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050506-110 rad50 "RAD50 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109292 Rad50 "RAD50 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NEG1 RAD50 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|621542 Rad50 "RAD50 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9JIL8 Rad50 "DNA repair protein RAD50" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9W252 | RAD50_DROME | 3, ., 6, ., -, ., - | 0.2869 | 0.8182 | 0.9256 | yes | N/A |
| Q92878 | RAD50_HUMAN | 3, ., 6, ., -, ., - | 0.2728 | 0.8316 | 0.9451 | yes | N/A |
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1491 | |||
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 1e-125 | |
| cd03240 | 204 | cd03240, ABC_Rad50, ATP-binding cassette domain of | 9e-23 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-20 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-19 | |
| cd03240 | 204 | cd03240, ABC_Rad50, ATP-binding cassette domain of | 6e-19 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-11 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 9e-11 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-10 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-09 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 2e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-07 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 1e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-06 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 6e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-06 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 9e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-05 | |
| cd03278 | 197 | cd03278, ABC_SMC_barmotin, ATP-binding cassette do | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| cd03221 | 144 | cd03221, ABCF_EF-3, ATP-binding cassette domain of | 3e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-05 | |
| pfam05622 | 713 | pfam05622, HOOK, HOOK protein | 4e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-05 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 6e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-05 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 7e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| cd09607 | 581 | cd09607, M3B_PepF_2, Peptidase family M3B Oligopep | 1e-04 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 4e-04 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 4e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 5e-04 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 9e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 0.001 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 0.001 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 0.001 | |
| pfam07926 | 132 | pfam07926, TPR_MLP1_2, TPR/MLP1/MLP2-like protein | 0.001 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.002 | |
| cd03279 | 213 | cd03279, ABC_sbcCD, ATP-binding cassette domain of | 0.002 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.003 | |
| COG5185 | 622 | COG5185, HEC1, Protein involved in chromosome segr | 0.003 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 0.003 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 0.004 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 0.004 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 0.004 | |
| PRK09039 | 343 | PRK09039, PRK09039, hypothetical protein; Validate | 0.004 |
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
Score = 422 bits (1087), Expect = e-125
Identities = 366/1374 (26%), Positives = 681/1374 (49%), Gaps = 126/1374 (9%)
Query: 2 ALLDQLHIMGIRNFPADKN--RVVRFQRPLTLIVGENGCGKTTIIECIKFALTNEYPQGA 59
A ++ I+G+R+F + +++ F PLT++VG NG GKTTIIEC+K+ T ++P G
Sbjct: 1 AKFLKMSILGVRSFGIEDKDKQIIDFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPG- 59
Query: 60 SSGKNFVHDPRIGKKDEASASSGKNFVHDPRIGKKDETHAIVKLQCTCENNDTVCVVRSL 119
+ G FVHDP++ ++ + A ++LQ N + VVRS+
Sbjct: 60 --------------------TKGNTFVHDPKVAQETDVRAQIRLQFRDVNGEECAVVRSM 99
Query: 120 LLSNKNGKDNCATRDTTISRKIFATGVQKNLGCLQQESVLEMCNLIGVSKAILNNVIFCH 179
+ + K K T + I+R V + C + + EM + +GVSKA+LNNVIFCH
Sbjct: 100 VCTQKTKKTEFKTLEGVITRYKHGEKVSLSSKCAEIDR--EMISHLGVSKAVLNNVIFCH 157
Query: 180 QENSSWPLDEGKKVKEIFDEIFDATKYNKALESIKIQRDRLRKEIPEIKAHYQATLNYKK 239
QE+S+WPL EGK +K+ FDEIF AT+Y KALE+++ R +++ E + + YK+
Sbjct: 158 QEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVQEHQMELKYLKQYKE 217
Query: 240 EADSKKQLIYNNTQKRDQSFEELHNIEESMKPINEKLVQLTEKERNMSVMSTQYQTKKTE 299
+A + I + + + S E + + E + P+ +L ++ + + + + K+
Sbjct: 218 KACEIRDQITSKEAQLESSREIVKSYENELDPLKNRLKEIEHNLSKIMKLDNEIKALKSR 277
Query: 300 RDMIQESCNELESSIKQLFSGDKAELQSKLNLFKINLDEKCSELENQERLKSQYIQEEKQ 359
+ +++ +ELE ++++F G +L + + + EK EL + +R + +E +
Sbjct: 278 KKQMEKDNSELELKMEKVFQGTDEQLNDLYHNHQRTVREKERELVDCQRELEKLNKERRL 337
Query: 360 SHTHINEAQMKLGKLERDEETHKKLNDTLKTKLNNLADTLCLDTTAKSQYTPEEGEGLIK 419
+ E ++ G+L+ + H++ + + +LA L LD + ++ + +
Sbjct: 338 LNQEKTELLVEQGRLQLQADRHQEHIRARDSLIQSLATRLELDGFERGPFSERQIKNFHT 397
Query: 420 MSQTTIDKYLSDIKILERTFSDNENTKQAEINALIVEKVELESKIKSFKQQIEGNKKDLT 479
+ + L E KQ + + + EK L I+ K+ +E +++L
Sbjct: 398 LVIERQEDEAKTAAQLCADLQSKERLKQEQADEIRDEKKGLGRTIELKKEILEKKQEELK 457
Query: 480 NVITQINEVNQSQSTLQVLQTKLNRVNSEIDQLSKSLDPDQLKNEIEAWIRQRNELEDEL 539
VI ++ ++ S + L +L + E+ + K+ + LK E+++ ++ +L+ +L
Sbjct: 458 FVIKELQQLEGSSDRILELDQELRKAERELSKAEKNSLTETLKKEVKSLQNEKADLDRKL 517
Query: 540 CVIDAEISILQAQNITLAEIKSLKNRKESKLADINLLKERHDRAFHLLFDMIPEENFKNS 599
+D E+ L T +++ L K K I +K RH L ++ K
Sbjct: 518 RKLDQEMEQLNHHTTTRTQMEMLTKDKMDKDEQIRKIKSRHSDE---LTSLLGYFPNKKQ 574
Query: 600 LDKALSSITFDINRIQEDINAKEKHLYTLEANVSNSSKTLRDQKRTLAELMDRMELVLGS 659
L+ L S + +IN+ ++ + K L +LE N ++ + L ++ L+ D++ V GS
Sbjct: 575 LEDWLHSKSKEINQTRDRLAKLNKELASLEQNKNHINNELESKEEQLSSYEDKLFDVCGS 634
Query: 660 KPFEDELDRVTLELKREQEEVSMMTSTQYLFNSYIGKL-EENEPRCPLCTRFFESDYSVP 718
+ E +L+R+ E+++ ++ +M+ +++ +I +L +EN+ CP+C R F+++ +
Sbjct: 635 QDEESDLERLKEEIEKSSKQRAMLAGATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQ 694
Query: 719 GLVNKLKTKIKEIPEQTNNKKTHIDQLCKQQRSLQELKPVYENIMKLQDTDIPSLRSKLI 778
++ L++K++ P++ + ++ + + K++ + L P ++I+ L++ +IP LR+KL
Sbjct: 695 EFISDLQSKLRLAPDKLKSTESELKKKEKRRDEMLGLAPGRQSIIDLKEKEIPELRNKLQ 754
Query: 779 ELEENVIETKGELKKLKTALETPKTKEKTALSLQGDLTLLDQNIRELNTLQRELERQESK 838
++ ++ K ++++ +T L T +E++A D+T++++ EL ++R++ +Q +K
Sbjct: 755 KVNRDIQRLKNDIEEQETLLGTIMPEEESAKVCLTDVTIMERFQMELKDVERKIAQQAAK 814
Query: 839 ISGMRSTGVDLD----QVLAQQKEKKNELNTFRSKIESGQTRLNSHNEKLQSLQKQKNDI 894
G DLD QV +++EK++EL+T SKIE + + E++Q L+ + N++
Sbjct: 815 -----LQGSDLDRTVQQVNQEKQEKQHELDTVVSKIELNRKLIQDQQEQIQHLKSKTNEL 869
Query: 895 HSKQLTVQGGAGMLKSLEDRKCELEGMDSVYQTELEELGRKVAPIETQLNLAQSELDAL- 953
S++L + + E++ EL E+++ + +P+ET L Q E + L
Sbjct: 870 KSEKLQIGTNLQRRQQFEEQLVELSTEVQSLIREIKDAKEQDSPLETFLEKDQQEKEELI 929
Query: 954 -KKEHKKKLNEEGAKIQDYTKQLEEVKRIKLEILNYTKRGTLTQLAALRESVQKLNQRKE 1012
KE K ++ K+ D ++++ + +I N + G L + +N + E
Sbjct: 930 SSKETSNKKAQD--KVNDIKEKVKNIHGYMKDIENKIQDGKDDYLKQKETELNTVNAQLE 987
Query: 1013 DIIAKRGVCERTINEINQSIANQSLEEIDLKNNLTLLEKKEAVAKLNEELK-----LSEI 1067
+ + + + Q I Q ++E L++NLTL +++ + ++ EELK + ++
Sbjct: 988 ECEKHQEKINEDMRLMRQDIDTQKIQERWLQDNLTLRKRENELKEVEEELKQHLKEMGQM 1047
Query: 1068 MISDLTKYHHTLE--------NCVIKYHSQKMRSINRLIRE--------------YWTRI 1105
+ + + H LE N V+ QK + Y +
Sbjct: 1048 QVLQMKQEHQKLEENIDLIKRNHVLALGRQKGYEKEIKHFKKELREPQFRDAEEKYREMM 1107
Query: 1106 YQLKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQGNDIDYISIAAD 1165
++ +E++ DL Y+ TL+ ++K+HS KM IN++IR+ W Y+G DI+YI I +D
Sbjct: 1108 IVMRTTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSD 1167
Query: 1166 VG---TGSEKRRTYNYRVVQKKNGIEQDMRNRCSAGQRVLACLIIRLFISDQKNFQLIVI 1222
+ S+KRR YNYRVV K DMR RCSAGQ+VLA LIIRL
Sbjct: 1168 ADENVSASDKRRNYNYRVVMLKGDTALDMRGRCSAGQKVLASLIIRL------------- 1214
Query: 1223 THDEEFIENLTAIDRAYVVRIVRDHKALAETFSRNCGIFALDEPTTNLD----------- 1271
ALAETF NCGI ALDEPTTNLD
Sbjct: 1215 --------------------------ALAETFCLNCGIIALDEPTTNLDRENIESLAHAL 1248
Query: 1272 ---IKNASDQKNFQLIVITHDEEFIENLTAIDRA-YVVRIVRDHKGLSDIHLRS 1321
IK+ S Q+NFQL+VITHDE+F+E L + R+ ++ S+I S
Sbjct: 1249 VEIIKSRSQQRNFQLLVITHDEDFVELLGRSEYVEKFYRLKKNEDQCSEIVKCS 1302
|
All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 1311 |
| >gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218661 pfam05622, HOOK, HOOK protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|189014 cd09607, M3B_PepF_2, Peptidase family M3B Oligopeptidase F (PepF) | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|149160 pfam07926, TPR_MLP1_2, TPR/MLP1/MLP2-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213246 cd03279, ABC_sbcCD, ATP-binding cassette domain of sbcCD | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1491 | |||
| KOG0962|consensus | 1294 | 100.0 | ||
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 100.0 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 100.0 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 100.0 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 100.0 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| KOG0996|consensus | 1293 | 100.0 | ||
| PRK01156 | 895 | chromosome segregation protein; Provisional | 100.0 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| KOG0962|consensus | 1294 | 100.0 | ||
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 100.0 | |
| KOG0964|consensus | 1200 | 100.0 | ||
| KOG0018|consensus | 1141 | 100.0 | ||
| KOG0933|consensus | 1174 | 100.0 | ||
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 100.0 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 100.0 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 100.0 | |
| PF13514 | 1111 | AAA_27: AAA domain | 99.98 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.96 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 99.96 | |
| KOG0250|consensus | 1074 | 99.92 | ||
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.91 | |
| KOG0161|consensus | 1930 | 99.9 | ||
| KOG0161|consensus | 1930 | 99.89 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.87 | |
| KOG0979|consensus | 1072 | 99.87 | ||
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.86 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 99.86 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.85 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.84 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.8 | |
| KOG4674|consensus | 1822 | 99.79 | ||
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.76 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.74 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.72 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.68 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.68 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.67 | |
| KOG0996|consensus | 1293 | 99.67 | ||
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.66 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.65 | |
| KOG4674|consensus | 1822 | 99.63 | ||
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.6 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 99.59 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.59 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.59 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.58 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.57 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.56 | |
| KOG0964|consensus | 1200 | 99.55 | ||
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.54 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.52 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.52 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.52 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 99.51 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.51 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.5 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 99.5 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.47 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.46 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.45 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.44 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.44 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.44 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 99.43 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.43 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.43 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.42 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.41 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.41 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.41 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.41 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.41 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.4 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 99.4 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.4 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.38 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.38 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.37 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 99.37 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.37 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.37 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.36 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.36 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.36 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.36 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.35 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.35 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.35 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 99.35 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.35 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.35 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.35 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.34 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.34 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.34 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.34 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 99.34 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.33 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.33 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.32 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.32 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.32 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.31 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.31 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.31 | |
| KOG0933|consensus | 1174 | 99.3 | ||
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 99.3 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.3 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.3 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.3 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.3 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.3 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.3 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.29 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.29 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 99.29 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.29 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.28 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.28 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.28 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.28 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.28 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 99.28 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.28 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.28 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.28 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.27 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.27 | |
| KOG0250|consensus | 1074 | 99.27 | ||
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.27 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.27 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.27 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 99.27 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.27 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.26 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.26 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.26 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 99.26 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.26 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.26 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.26 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.26 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 99.26 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.26 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.26 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 99.26 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 99.25 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.25 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.25 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 99.25 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.25 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.25 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.25 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.24 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.24 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.24 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 99.23 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.23 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.23 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.23 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 99.23 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.23 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.23 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 99.23 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.23 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.23 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.22 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.22 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.22 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.22 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.22 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.22 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.22 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.22 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.22 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.22 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.21 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.21 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.21 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.21 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.21 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.21 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.2 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.2 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 99.2 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.2 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.2 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.2 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.2 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.2 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.2 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.19 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.19 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 99.19 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.19 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 99.19 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.18 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 99.18 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.18 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.18 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.18 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.18 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.18 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.18 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.18 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.16 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.16 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.16 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.16 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.16 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.16 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.16 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.16 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.15 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.15 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.15 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.15 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.15 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.15 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.15 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.15 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.14 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.14 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.14 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.14 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.14 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.14 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.14 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.14 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.14 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.14 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.14 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.13 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.13 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 99.13 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.13 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 99.13 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 99.13 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.13 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 99.13 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.13 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.12 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.12 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.12 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.12 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.12 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.12 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 99.12 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.12 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.12 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.12 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.11 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.11 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.11 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.11 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.11 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.11 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.11 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.11 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.11 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.11 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.11 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.11 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 99.11 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.11 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.1 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.1 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.1 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.1 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.1 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.1 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.1 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.1 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.1 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.1 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.1 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.09 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.09 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 99.09 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.09 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.09 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.09 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.09 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 99.09 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.09 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 99.09 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.09 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.09 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.08 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.08 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.08 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.08 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.08 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.08 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 99.08 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.08 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.08 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 99.08 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.07 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.07 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.07 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.07 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.07 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.07 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.07 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.07 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.07 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.07 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 99.07 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.07 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 99.07 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.06 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.06 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.06 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.06 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.06 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.06 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.06 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.06 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.06 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.06 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.06 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.06 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.06 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.06 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.06 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.06 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.05 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.05 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.05 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 99.05 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.05 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.05 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 99.05 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.05 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.05 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 99.05 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.05 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.05 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.05 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.05 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.05 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.04 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.04 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.04 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 99.04 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.04 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.04 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.04 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 99.04 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.04 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.04 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.04 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.04 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.04 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.04 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.04 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.04 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.04 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.04 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.04 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.04 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.04 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.03 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.03 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 99.03 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.03 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.03 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.03 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.03 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.03 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.03 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.03 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.03 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.03 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.03 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.03 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 99.03 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.03 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.03 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.02 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.02 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.02 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.02 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.02 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.02 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 99.02 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.02 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.02 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.02 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.02 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.02 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.02 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.02 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.01 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.01 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.01 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.01 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.01 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.01 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.01 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.01 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 99.0 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 99.0 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.0 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.0 | |
| KOG0055|consensus | 1228 | 99.0 | ||
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.0 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.0 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.0 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 99.0 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.0 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.0 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 99.0 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 99.0 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.0 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.0 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.0 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.0 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.0 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 98.99 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 98.99 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 98.99 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 98.99 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 98.99 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 98.99 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 98.99 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 98.99 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 98.99 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 98.99 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.99 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 98.99 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 98.98 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 98.98 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 98.98 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.98 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 98.98 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.98 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 98.98 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 98.98 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 98.98 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 98.97 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 98.97 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 98.97 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 98.97 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 98.97 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 98.97 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 98.97 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 98.97 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 98.97 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 98.96 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 98.96 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 98.96 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 98.96 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 98.96 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 98.96 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 98.96 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 98.96 | |
| KOG0994|consensus | 1758 | 98.96 | ||
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 98.96 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 98.95 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 98.95 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.95 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.95 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 98.95 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 98.95 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 98.95 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 98.94 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 98.94 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 98.94 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 98.94 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.94 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 98.94 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 98.94 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 98.94 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 98.94 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 98.94 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 98.93 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 98.93 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 98.93 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 98.93 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 98.93 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 98.93 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 98.93 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 98.93 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 98.93 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 98.93 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.93 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 98.93 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.93 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.93 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 98.92 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.92 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 98.92 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.92 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.92 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 98.92 |
| >KOG0962|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.8e-110 Score=1015.61 Aligned_cols=1236 Identities=30% Similarity=0.448 Sum_probs=1056.1
Q ss_pred CCcccceeeecccccCCCCcceEEeeccceEEEccCCCChhhHHHHHHhhhcCCCCCCCCCCceEeeCCCCCCCcHHHhh
Q psy9513 1 MALLDQLHIMGIRNFPADKNRVVRFQRPLTLIVGENGCGKTTIIECIKFALTNEYPQGASSGKNFVHDPRIGKKDEASAS 80 (1491)
Q Consensus 1 m~~~~~l~i~~~~~~~~~~~~~i~f~~~~~~i~G~NGaGKStl~~~i~~~l~g~~~~~~~~g~~~~~~~~~~~~~~~~~~ 80 (1491)
|+.|.+|+|.||+|||+++.+.|.|..|+|+||||||||||||+.|++||++|.+||++ +|+.|+|+|.+
T Consensus 1 Ms~i~klsI~GIRSf~~~d~~~i~F~sPlTLIvG~NG~GKTTiIEcLKyatTG~lPpns-k~~~FiHdpkI--------- 70 (1294)
T KOG0962|consen 1 MSSIDKLSIRGIRSFDDKDRNTIEFFSPLTLIVGANGTGKTTIIECLKYATTGELPPNS-KGGSFIHDPKV--------- 70 (1294)
T ss_pred CchhHhhHhhcccccCCcccceeeecCCeeeEecCCCCCchhHHHHHHHHhcCcCCCCC-cCCCCCCCccc---------
Confidence 88899999999999997777999999999999999999999999999999999999999 78899999999
Q ss_pred cCccccccCCCCCCccHHHHHHhhccccCCCceEEEEeEEEEeecCCccccccccceEeeecCCCceeee--ccccchhh
Q psy9513 81 SGKNFVHDPRIGKKDETHAIVKLQCTCENNDTVCVVRSLLLSNKNGKDNCATRDTTISRKIFATGVQKNL--GCLQQESV 158 (1491)
Q Consensus 81 ~~~~~~q~~~~~~~~~~~~~v~~~~~~~~~~~~~i~r~~~~~~~~g~~~~~~~~~~~~~~~~~~g~~~~~--~~~q~~~~ 158 (1491)
.+-..|.|.|.|.|.+.+|..+.+.|++..+.+..+..++++++.+..+ .+|+..++ +|. ++|
T Consensus 71 -----------age~ev~AqvkL~f~~~~G~~~~~~R~~qlt~k~~~~~~ktles~~~~~--~~g~k~tlS~r~~--d~d 135 (1294)
T KOG0962|consen 71 -----------AGETEVRAQVKLAFTDVNGETMICTRTIQLTQKRTKMEFKTLESVIWAI--NDGDRVTLSGRSA--DLD 135 (1294)
T ss_pred -----------cchhhhhheeeeeeecCCCcEEEeehhhHHHHHHHHHHHHHHhhhheee--ecCccccccchhh--hhh
Confidence 6667789999999999999999999999998777788899999998888 56776666 899 999
Q ss_pred HHhHhhhCCcHhhhhcceeeccCCCCCCCCcchhhHHHHHHhhhhhhHHHHHHHHHHhHHHHhhhhHHHHHHHHHhHhHH
Q psy9513 159 LEMCNLIGVSKAILNNVIFCHQENSSWPLDEGKKVKEIFDEIFDATKYNKALESIKIQRDRLRKEIPEIKAHYQATLNYK 238 (1491)
Q Consensus 159 ~~i~~~~g~~~~~~~~~~f~~q~e~~~~l~~~~~~k~~~~~i~g~~~~~~~~~~lk~~~d~~~k~~~~~~~~~~~~l~~~ 238 (1491)
..||..+||+++||+|||||||.++.|||++|+.++..||+||++++|.++++.+++ ++++....++..+..++++
T Consensus 136 ~~~~~~lGVskAIl~~VIFcHQEdS~WPLsEp~~LKkkfD~IF~~tky~KAld~~kk----~rkd~~~evk~~~~~l~~l 211 (1294)
T KOG0962|consen 136 AEMPLHLGVSKAILENVIFCHQEDSTWPLSEPKNLKKKFDDIFSATKYTKALDSLKK----LRKDQSQEVKTKKQELEHL 211 (1294)
T ss_pred HHHHHhcCCcHHHHhhhheecccCCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999999 9999999999999999988
Q ss_pred H---HHHHHHHHHHHHHHHHHHHH-HHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy9513 239 K---EADSKKQLIYNNTQKRDQSF-EELHNIEESMKPINEKLVQLTEKERNMSVMSTQYQTKKTERDMIQESCNELESSI 314 (1491)
Q Consensus 239 ~---~~~~~~~~~l~~~~~~~~~~-~~~~~l~~~l~~l~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~l~~~~ 314 (1491)
+ +.....+..+......+... .+..+++.++.+......+++....++..+..+...+..+...+..++..+...+
T Consensus 212 k~~K~~~e~~~l~i~~~~~ki~~~ke~v~e~e~e~~~~~~~i~ei~~~~~el~k~~~~~~~l~~e~~~l~~~~~~l~~~i 291 (1294)
T KOG0962|consen 212 KTLKERAEVLRLNIHSGQRKIEKSKEEVSELENELGPIEAKIEEIEKSLKELEKLLKQVKLLDSEHKNLKKQISRLREKI 291 (1294)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence 8 88889999999999999999 9999999999999999999999999999999999999999999999999999999
Q ss_pred hhhccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchHHHHHHHHHHHHHHHHHHHH
Q psy9513 315 KQLFSGDKAELQSKLNLFKINLDEKCSELENQERLKSQYIQEEKQSHTHINEAQMKLGKLERDEETHKKLNDTLKTKLNN 394 (1491)
Q Consensus 315 ~~~~~~~~~el~~~l~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~l~~~~~~l~~~~~~~~~~i~~~~~~i~~ 394 (1491)
...+.+++..+...+.+|...+.........++.++..+..+...+......+..+.+.++.....+..........++.
T Consensus 292 ~~~~~~t~~~l~~~~~n~~~~~~~~~~~~~~~e~~~~~l~~e~~~l~~~k~~~~~~~~~lq~e~~~~~~l~~~~~~~~~~ 371 (1294)
T KOG0962|consen 292 LKIFDGTDEELGELLSNFEERLEEMGEKLRELEREISDLNEERSSLIQLKTELDLEQSELQAEAEFHQELKRQRDSLIQE 371 (1294)
T ss_pred ccccccchHHHHHHHHhHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 45789999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhHcCCCCCCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy9513 395 LADTLCLDTTAKSQYTPEEGEGLIKMSQTTIDKYLSDIKILERTFSDNENTKQAEINALIVEKVELESKIKSFKQQIEGN 474 (1491)
Q Consensus 395 l~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~l~~~~~~~~~~~~~~i~~l~~~l~~l~~~~~~~~~~l~~~ 474 (1491)
+...+....+........-...+-.-+...+.....++.+........ ++.+..++..+......+..........
T Consensus 372 ~~~~~~~~~~~~~~~~~~v~~~~~~~i~~~~~~~~~~~~q~~k~~~~~----~s~~~~~~~~~~~~~~~l~~~~~~~~~~ 447 (1294)
T KOG0962|consen 372 LAHQYQLDSVESLEFMAEVKKDFRNLILERFGGLEDDIKQRKKDIAEL----ETNALDLIKEITDREVSLEAQKRIKDEI 447 (1294)
T ss_pred HHHHHHhhcccccchHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHH----HhhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 888887654444322222122222333344444445555544444333 3444444444444444444444333333
Q ss_pred HH-HHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHhccCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHch
Q psy9513 475 KK-DLTNVITQINEVNQSQSTLQVLQTKLNRVNSEIDQLSKSLDPDQLKNEIEAWIRQRNELEDELCVIDAEISILQAQN 553 (1491)
Q Consensus 475 ~~-~~~~l~~~l~~l~~~~~~l~~le~~l~~~~~el~~l~~~~~~~~l~~~l~~~~~~~~~le~~l~~l~~el~~l~~~~ 553 (1491)
.. +...+...+.........+..+...+......+..+........+...+...+..+..++..+..+...+..++..+
T Consensus 448 ~~~E~k~l~~~~~~~e~s~~~~~~~~~r~~~~~~~~~s~~~~~~~~~l~e~i~~~q~~~~~l~~~~kk~~~~~~~~~~~~ 527 (1294)
T KOG0962|consen 448 KKLESKGLKDKSFQYEDSTDDLKKLDERLKEAERLLESAEKNNDELALKEKIAEKQNEMAQLEIQKKKLDEELDGLNKDA 527 (1294)
T ss_pred HHHHHHhHHHHHHHhhhhHhhHHHHHHHHHHHHHHHHhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhH
Confidence 33 44555555555555555667777777777788888777667788899999999999999999999999999999999
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHhcCCCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy9513 554 ITLAEIKSLKNRKESKLADINLLKERHDRAFHLLFDMIPEENFKNSLDKALSSITFDINRIQEDINAKEKHLYTLEANVS 633 (1491)
Q Consensus 554 ~~~~~l~~l~~~~~~~~~~v~~~~~~~~~~l~~i~g~~~~~~~~~aie~~L~~~~~~i~~~~~~i~~lk~~~~r~~~~l~ 633 (1491)
..++.+.++......+...++.+..++.+.+....+.+... ...++..+......+....+..+.+......+.....
T Consensus 528 ~~~~~~~~~~k~~~~k~~~~~k~~~~~~~~~~~~~~~~~~~--~~~le~~~~~~~~~~~~~~ek~~~l~~~~~~~e~~~~ 605 (1294)
T KOG0962|consen 528 EKRAKLELLKKKLRKKDAELRKIKSRLSDEKGRAIEFPLTN--DRSLEKELHKLSKEIQEMEERLRMLQLEEQSLEINRN 605 (1294)
T ss_pred HHHHHHHHHHHHHHhHHHHHHHHHHhcchhhhhhhccCccc--hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999998888888877766554444432211 1578888999999999999999988888888888888
Q ss_pred hhHHHHH-HHHHHHHHHHHHHHhhhCC-CChHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHhhcCCCCccccccC
Q psy9513 634 NSSKTLR-DQKRTLAELMDRMELVLGS-KPFEDELDRVTLELKREQEEVSMMTSTQYLFNSYIGKLEENEPRCPLCTRFF 711 (1491)
Q Consensus 634 ~~~~~l~-~~~~~l~~~~~~l~~~~~~-~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 711 (1491)
.+...++ ..+..+......+...+|. .+|.+.|..++.++......+..+.....+|+.|+.++... ||||+|.++|
T Consensus 606 ~~~~~~e~~~~e~~k~~~~~lk~~sgt~~~~~~~le~l~~eie~~rk~l~~lq~~s~~Y~k~Ie~~~~~-~~CplC~r~f 684 (1294)
T KOG0962|consen 606 GIRKDLEDRKEEELKSKEFFLKDESGTIDEYLDLLERLKGEIEKARKDLAMLQGRSALYRKFIEIACRS-HCCPLCQRSF 684 (1294)
T ss_pred HhhhhHHHHHHHHHHHHHHHHHhhccchhhHHHHHHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHhhc-cCCCccCCcc
Confidence 8887777 4455555555677777776 88999999999999999999999999999999999999986 9999999999
Q ss_pred CCCCchhhHHHHHHHHhhhchhhhhhhHHHHHHHHHHHHHHHhhchHHHHHHhhccCCcchHHHHHHHHHHHHHHHHHHH
Q psy9513 712 ESDYSVPGLVNKLKTKIKEIPEQTNNKKTHIDQLCKQQRSLQELKPVYENIMKLQDTDIPSLRSKLIELEENVIETKGEL 791 (1491)
Q Consensus 712 ~~~~~l~~~i~~l~~~l~~~~~~~~~~~~~~~~l~~~~~~l~~l~~~~~~~~~l~~~ei~~l~~~l~~l~~~l~~~~~~~ 791 (1491)
+.... ..++.+|...+...|+.+..+...+.......+.+..+.+....+.++....++.++.+++.....+.....+.
T Consensus 685 ~~eee-~ef~~~l~~~i~s~p~~~~~~~~~l~k~~k~~e~l~~~~~~~~~~~~l~~~~i~e~~~~l~~~~~el~~~~~~~ 763 (1294)
T KOG0962|consen 685 TTEEE-VEFIKKLESKIDSAPDKLEEAEVELSKEEKIFEILLKLKPTFGSIIKLIDKEIPELEKELQEVYEELGDLSEEE 763 (1294)
T ss_pred chHHH-HHHHHHHHHHHhccchhHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHhhhhhHHHHHHHHHHHHHHhhhhhh
Confidence 98744 78899999999999999999999999888887777778999886777656699999999999999999999999
Q ss_pred HHHHHhhcCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q psy9513 792 KKLKTALETPKTKEKTALSLQGDLTLLDQNIRELNTLQRELERQESKISGMRSTGVDLDQVLAQQKEKKNELNTFRSKIE 871 (1491)
Q Consensus 792 ~~~e~~~~~~~~~~~~~~~l~~~~~~l~~l~~~~~~l~~~i~~le~~l~~~~~~~~~~~~l~~el~~~~~~~~~l~~~i~ 871 (1491)
+..+..+..+......+..+..+...++.+..++.....+++.+...+.........+.+++.+...+...+..+..+++
T Consensus 764 e~~~~~l~~~~~~~~~~~~l~~~~~~~e~~~~d~~~~~k~ie~~~s~l~~~~d~i~t~~E~~~Ek~~~~~~~~~~rke~E 843 (1294)
T KOG0962|consen 764 EDDEKLLDTIDAAEESAETLQTDVTVLERFLKDLKLREKEIEELVSELDSSVDGIRTVDELRKEKSKKQESLDKLRKEIE 843 (1294)
T ss_pred hHHHHHhcccchhHHhHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHhccccccchhhHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999988888889999999999999999999999999977555788899999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhHHHHHHHHHhhHHHHHHHHHHHhhhhcchHHHHHHHHHHHH
Q psy9513 872 SGQTRLNSHNEKLQSLQKQKNDIHSKQLTVQGGAGMLKSLEDRKCELEGMDSVYQTELEELGRKVAPIETQLNLAQSELD 951 (1491)
Q Consensus 872 ~l~~~i~~~~~~i~~l~~~~~~l~~~~~~~~~~~~~~~~l~~~i~~~~~~~~~l~~~l~~~~~~~~~l~~~~~~l~~~~~ 951 (1491)
.++.........++.+....+........+...++...++++.+.++.+.+..+...+..+...+.++...+.++.++..
T Consensus 844 ~~~k~~~~~~~~i~~l~~~~~e~k~~~~~~~~~l~~~~qle~~~~~l~e~~~~~~s~~~e~~~~~~~~~~~l~e~~s~~e 923 (1294)
T KOG0962|consen 844 CLQKEVIEQEREISRLINLRNELKEEKQKIERSLARLQQLEEDIEELSEEITRLDSKVKELLERIQPLKVELEEAQSEKE 923 (1294)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHhhHhhhcchhhhHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHH
Q psy9513 952 ALKKEHKKKLNEEGAKIQDYTKQLEEVKRIKLEILNYTKRGTLTQLAALRESVQKLNQRKEDIIAKRGVCERTINEINQS 1031 (1491)
Q Consensus 952 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~~~~~~~~l~~~~~~~~~l~~~~~~l~~~~~~~~~~l~~~~~~ 1031 (1491)
...++........++.+.++......+..+..-...+...+. ..+. ...+..+...++.+.+++......
T Consensus 924 ~~k~~~~~~~~~aqk~~~~ine~~s~l~~~~~~~~~~~~~~~----~~~~------~~~l~~~~e~l~~~~~~~~~~~~~ 993 (1294)
T KOG0962|consen 924 ELKNERNTSEKLAQKKRNDINEKVSLLHQIYKLNECFEQYGF----DDLR------IAQLSESEEHLEERDNEVNEIKQK 993 (1294)
T ss_pred HHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHhh----hhhc------hHHHHHHHHHHHHHHHHHHHHHHH
Confidence 888875554444444444444444433333333332222111 0111 455666777788888999999999
Q ss_pred HhhhhhhhhchHhhHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHh-------H-------------HHHHH
Q psy9513 1032 IANQSLEEIDLKNNLTLLEKKEAVAKLNEELKLSEIM-----ISDLTKYHHTLE-------N-------------CVIKY 1086 (1491)
Q Consensus 1032 i~~~~~~~~~~~d~~~~~~~~~~~~~~~~~l~~l~~~-----~~~l~~~~~~L~-------~-------------~~i~~ 1086 (1491)
++.+...+++++||++|+.+..+++++..++..+... +..+..++..|. . .+++.
T Consensus 994 l~~~~~~er~l~dnl~~~~l~~q~~e~~re~~~ld~Qi~~~~~~~~~ee~~~L~~~~~~l~se~~~~lg~~ke~e~~i~~ 1073 (1294)
T KOG0962|consen 994 IRNQYQRERNLKDNLTLRNLERKLKELERELSELDKQILEADIKSVKEERVKLEEEREKLSSEKNLLLGEMKQYESQIKK 1073 (1294)
T ss_pred HHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHhhhHhhHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999998887222 222222222222 2 66777
Q ss_pred HHHHhh-HHhHHH-HHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHhcccCCCcceeEEeec
Q psy9513 1087 HSQKMR-SINRLI-REYWTRIYQLKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIREYWTRIYQGNDIDYISIAA 1164 (1491)
Q Consensus 1087 ~~~e~~-~~~k~i-~~y~~~~~~~~~~~~~~~dl~~~~~~l~~~~~~y~~~k~~~in~~~~e~~~~~~~G~~i~~i~I~~ 1164 (1491)
..+++. +.|+++ .+|+.++|++.++.+++.|+++|++|||.|+|+||++||.+||+||++||..+|+|+|||||.|++
T Consensus 1074 ~k~eL~~~~~kd~~~nyr~~~ie~~tt~~~~~DL~ky~~aLD~Aim~fHs~KMeeiN~iI~elW~~tYrG~Did~IrIrs 1153 (1294)
T KOG0962|consen 1074 LKQELREKDFKDAEKNYRKALIELKTTELSNKDLDKYYKALDKAIMQFHSMKMEEINRIIRELWRKTYRGTDIDYIKIRS 1153 (1294)
T ss_pred HHHHhhhhhhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCcceEEEee
Confidence 777865 889999 999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCCCcccceeEEEEeccccccccccccchhhHHHHHHHHHHhhhhcccceEEEEccchhhhhhhhhHHHHhHHHHh
Q psy9513 1165 DVGTGSEKRRTYNYRVVQKKNGIEQDMRNRCSAGQRVLACLIIRLFISDQKNFQLIVITHDEEFIENLTAIDRAYVVRIV 1244 (1491)
Q Consensus 1165 ~~~~~~~~~~~yn~~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~~~~~~~~n~~l~~i~~~~~~~~~L~~~~~~~~~~l~ 1244 (1491)
|.++.+.+++||||+|||.++++++||+++||+|+++|||+|||+
T Consensus 1154 D~~~s~~~~rsYnyrVv~~kgd~eldMRGRcSAGQKvLAsliIRL----------------------------------- 1198 (1294)
T KOG0962|consen 1154 DSVSSSDKRRTYNYRVVMVKGDTELDMRGRCSAGQKVLASLIIRL----------------------------------- 1198 (1294)
T ss_pred ccccccccccccceeEEEEechHHHHhccCccchHHHHHHHHHHH-----------------------------------
Confidence 988866788999999999999999999999999999999999999
Q ss_pred hhHHHHHHHhhcCCCeeEEcCCCCCCChHhH--------------HhhcCceEEEEccCHHHHHHHhcccc-ceEEEEec
Q psy9513 1245 RDHKALAETFSRNCGIFALDEPTTNLDIKNA--------------SDQKNFQLIVITHDEEFIENLTAIDR-AYVVRIVR 1309 (1491)
Q Consensus 1245 ~~~~~~a~~~~~~~~~l~lDEp~~~lD~~~~--------------~~~~~~~~i~~thd~~~~~~~~~~~~-~~~~~l~~ 1309 (1491)
|+|.+||.+|++|.|||||++||..++ ..+.+|++|+||||.+|+..++.++| ++||++.+
T Consensus 1199 ----ALAEtf~snCgvLALDEPTTNLD~~niesLa~~L~~II~~rr~q~nfqLiVITHDE~fv~~i~~~~~~e~~yr~~k 1274 (1294)
T KOG0962|consen 1199 ----ALAETFGSNCGVLALDEPTTNLDRENIESLAKALSRIIEERRRQRNFQLIVITHDEDFVQLLGRSAYPEYFYRVKK 1274 (1294)
T ss_pred ----HHHHHHhhccccccccCCccccCHhHHHHHHHHHHHHHHHHhhccCcceeeeehHHHHHHHhhhcccchheeeecc
Confidence 999999999999999999999999998 45669999999999999999998888 99999999
Q ss_pred CCCcceeeeeccc
Q psy9513 1310 DHKGLSDIHLRSL 1322 (1491)
Q Consensus 1310 ~~~~~~~i~~~~~ 1322 (1491)
+..++|.+.+.++
T Consensus 1275 d~~~~s~i~~~~~ 1287 (1294)
T KOG0962|consen 1275 DESQISMIVKHSI 1287 (1294)
T ss_pred cchhcceeeeecC
Confidence 9999988888653
|
|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1491 | ||||
| 3aux_A | 371 | Crystal Structure Of Rad50 Bound To Adp Length = 37 | 2e-04 | ||
| 3qf7_A | 365 | The Mre11:rad50 Complex Forms An Atp Dependent Mole | 8e-04 |
| >pdb|3AUX|A Chain A, Crystal Structure Of Rad50 Bound To Adp Length = 371 | Back alignment and structure |
|
| >pdb|3QF7|A Chain A, The Mre11:rad50 Complex Forms An Atp Dependent Molecular Clamp In Dna Double-Strand Break Repair Length = 365 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 96.5 bits (239), Expect = 4e-20
Identities = 108/744 (14%), Positives = 226/744 (30%), Gaps = 210/744 (28%)
Query: 607 ITFDINRIQ---EDINAKEKHLYTLEANVSNSSKTLRDQKRTLAELMDRMELVLGSKPFE 663
+ F+ Q +DI L D K ++ D + +L +
Sbjct: 7 MDFETGEHQYQYKDI---------LSVFEDAFVDNF-DCK----DVQDMPKSILSKE--- 49
Query: 664 DELDRVTLELKREQEEVSMMTSTQYLFNSYIGKLEENEPRCPLCTRFFES----DYSVPG 719
E+D + + T LF + + K EE + +F E +Y
Sbjct: 50 -EIDHIIMSKDAVSG-------TLRLFWTLLSKQEE------MVQKFVEEVLRINYKF-- 93
Query: 720 LVNKLKTKIKEIPEQTN-NKKTHIDQLCKQQRSLQELKPVYENIMKLQDTDIPSLRSKLI 778
L + IK Q + + +I+Q + Q N+ +LQ LR L+
Sbjct: 94 ----LMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKY--NVSRLQP--YLKLRQALL 145
Query: 779 EL--EENVIETKGELKKLKTALETPKTKEKTALSLQGDLTLLDQNIRELNTLQ------R 830
EL +NV+ ++ KT ++L L ++ + +
Sbjct: 146 ELRPAKNVL------------IDGVLGSGKTWVALD---VCLSYKVQCKMDFKIFWLNLK 190
Query: 831 ELERQESKISGMRSTGVDLDQVLAQQKEKKNELNTFRSKIESGQTRLNSHNEKLQSLQKQ 890
E+ + ++ +D + + + + + +I S Q L +L +
Sbjct: 191 NCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNI---KLRIHSIQAELR----RLLKSKPY 243
Query: 891 KN-----------------DIHSKQL--T--------VQGGAGMLKSLEDRKCELEGMDS 923
+N ++ K L T + SL+ L
Sbjct: 244 ENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLT---- 299
Query: 924 VYQTELEELGRKVAPIETQLNLAQSEL-DALKKEHKKKLNEEGAKIQDYTKQLEEVKRIK 982
E++ L K L+ +L + + ++L+ I+D + K +
Sbjct: 300 --PDEVKSLLLKY------LDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVN 351
Query: 983 LEILNYTKRGTLTQL--AALRESVQKLNQRKEDIIAKRGVCERTINEINQSIANQSLEEI 1040
+ L +L L A R+ +L+ I I S+ + +
Sbjct: 352 CDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSA---------HIPTILLSLIWFDVIKS 402
Query: 1041 DLKNNLTLLEKKEAVAKLNEELKLSEIMISDLTKYHHTLENCVIKYHSQKMRSINRLIRE 1100
D+ + L K V K +E +S +K + +++R I +
Sbjct: 403 DVMVVVNKLHKYSLVEKQPKESTIS---------IPSIY--LELKVKLENEYALHRSIVD 451
Query: 1101 YWTRIYQLKLSEIMISDLTKY--HHTLENCVIKYHSQKMRSINRLIREYWTRIYQGNDID 1158
++ +++ L +Y H I +H + + R+ + ++
Sbjct: 452 HYNIPKTFDSDDLIPPYLDQYFYSH------IGHHLKNIEHPERM--TLFRMVFL----- 498
Query: 1159 YISIAADVGTGSEKRRTYNYRVVQKKNGIEQDMRNRCSAGQRVLACLIIRLFISDQKNFQ 1218
++R +++K I D ++G +L L K ++
Sbjct: 499 ------------------DFRFLEQK--IRHDSTAWNASGS-ILNTL------QQLKFYK 531
Query: 1219 LIVITHDEEFIENLTAIDRAYVVRIVRDHKALAETFSRNCGIFALDEPTTNLDIKNASDQ 1278
+ +D ++ + AI F + T+L
Sbjct: 532 PYICDNDPKYERLVNAI----------------LDFLPKIEENLICSKYTDL-------- 567
Query: 1279 KNFQLIVITHDEE-FIENLTAIDR 1301
++ ++ DE F E + R
Sbjct: 568 --LRIALMAEDEAIFEEAHKQVQR 589
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Length = 203 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Length = 149 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Length = 182 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1491 | |||
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.79 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 99.66 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.58 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 99.57 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 99.57 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.56 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 99.53 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.53 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.52 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.49 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.49 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.46 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.45 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.44 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.44 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.44 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.44 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.43 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.43 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.43 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.43 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.42 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.42 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.42 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.42 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.41 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.39 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.39 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.38 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.36 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 99.34 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.31 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.28 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.28 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.28 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.27 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.27 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.27 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.26 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.26 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.26 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 99.26 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.25 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.25 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.25 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.24 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.24 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.24 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.24 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.23 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.22 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.21 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.21 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.21 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.21 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.2 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.19 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.19 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.18 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.18 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.18 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.18 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.17 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.15 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.15 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.14 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.14 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.14 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.14 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.13 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 99.13 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 99.13 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 99.13 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.13 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 99.13 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.12 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.09 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.09 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.08 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.08 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.08 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.07 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.06 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 99.06 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.06 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.06 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.06 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.05 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.02 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.01 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.01 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.01 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 99.0 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 98.99 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 98.94 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 98.94 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 98.93 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 98.92 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 98.9 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 98.89 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 98.89 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 98.86 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 98.86 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.86 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.85 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 98.84 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 98.84 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 98.83 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 98.83 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 98.81 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 98.81 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 98.8 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 98.76 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 98.73 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 98.7 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.7 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 98.68 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 98.66 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 98.65 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 98.62 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 98.56 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.53 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.52 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 98.49 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 98.49 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 98.49 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 98.46 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 98.43 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 98.43 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 98.43 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 98.4 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 98.37 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 98.37 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 98.29 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 98.24 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 98.2 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 98.2 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.19 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 98.17 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 98.17 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.14 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 98.13 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 98.11 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.06 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 98.02 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.02 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 98.01 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 98.01 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.97 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 97.94 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 97.93 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.9 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.89 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 97.88 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.87 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 97.86 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.85 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 97.8 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 97.79 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 97.78 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 97.78 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.75 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.73 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.73 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 97.73 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.71 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 97.68 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.67 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 97.66 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.61 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.6 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 97.59 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.58 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 97.55 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 97.54 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 97.52 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 97.51 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 97.5 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 97.49 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 97.49 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 97.47 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.4 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 97.4 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.38 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.3 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.28 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.27 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.27 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.25 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 97.25 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.22 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.2 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 97.19 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 97.16 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.14 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 97.11 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 97.06 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.02 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.02 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.02 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.01 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 96.96 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 96.96 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 96.94 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.92 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 96.91 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 96.87 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 96.87 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.83 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.82 | |
| 3l51_B | 166 | Structural maintenance of chromosomes protein 4; s | 96.79 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.78 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 96.77 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 96.75 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.74 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 96.74 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 96.71 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 96.71 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.69 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.66 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 96.65 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 96.64 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 96.64 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 96.63 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.62 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 96.62 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.61 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.54 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.52 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.48 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 96.47 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.45 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 96.4 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.4 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 96.39 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 96.37 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.32 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 96.32 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 96.3 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 96.29 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.27 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 96.27 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 96.26 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.25 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 96.22 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 96.21 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.2 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.18 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 96.09 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.08 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 96.08 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 96.05 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.04 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 95.99 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 95.88 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.86 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 95.76 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 95.71 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 95.7 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 95.68 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 95.66 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 95.56 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.52 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 95.46 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 95.44 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.43 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 95.38 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 95.37 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 95.35 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.31 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 95.29 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 95.28 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 95.18 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 95.16 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 95.14 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 95.12 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.11 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 95.11 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 95.09 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 95.08 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 95.04 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 95.02 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 94.95 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 94.89 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.86 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 94.83 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.82 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 94.71 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 94.64 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 94.64 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 94.63 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 94.63 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 94.58 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 94.5 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 94.5 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.47 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 94.44 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 94.44 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 94.39 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 94.32 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 94.17 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 94.06 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 94.04 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 94.02 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 94.0 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 93.97 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 93.93 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 93.91 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 93.85 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 93.84 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 93.78 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 93.74 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 93.7 | |
| 3nwc_A | 189 | SMC protein; structural maintenance of chromosomes | 93.7 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 93.67 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 93.65 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 93.61 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 93.61 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 93.55 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 93.55 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 93.51 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 93.43 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 93.42 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 93.41 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 93.36 | |
| 1gxl_A | 213 | SMC, chromosome segregation SMC protein; SMC dimer | 93.3 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 93.28 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 93.26 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 93.25 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 93.17 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 93.16 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 93.15 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 92.94 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 92.93 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 92.93 | |
| 3l51_A | 161 | Structural maintenance of chromosomes protein 2; s | 92.91 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 92.84 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 92.75 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 92.64 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 92.63 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 92.41 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 92.21 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 92.03 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 91.99 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 91.97 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 91.96 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 91.95 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 91.92 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 91.91 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 91.83 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 91.83 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 91.76 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 91.71 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 91.65 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 91.6 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 91.59 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 91.58 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 91.53 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 91.5 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 91.5 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 91.47 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 91.45 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 91.38 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 91.35 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 91.33 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 91.33 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 91.32 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 91.29 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 91.28 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 91.22 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 91.17 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 91.12 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 91.1 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.09 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 91.06 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 91.05 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 91.04 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 91.04 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 91.03 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 91.01 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 91.01 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 90.97 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 90.96 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 90.94 | |
| 1gxj_A | 186 | SMC, chromosome segregation SMC protein; SMC dimer | 90.92 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 90.91 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 90.87 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 90.84 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 90.81 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 90.79 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 90.78 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 90.75 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 90.71 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 90.7 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 90.67 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 90.66 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 90.64 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 90.61 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 90.6 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 90.56 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 90.56 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 90.54 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 90.51 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 90.5 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 90.41 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 90.41 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 90.39 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 90.38 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 90.36 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 90.36 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 90.35 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 90.3 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 90.29 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 90.25 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 90.23 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 90.2 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 90.18 | |
| 2wd5_A | 233 | Structural maintenance of chromosomes protein 1A; | 90.17 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 90.14 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 90.13 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 90.08 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 90.06 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 90.05 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 90.04 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 90.02 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 89.99 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 89.95 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 89.95 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 89.94 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 89.9 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 89.85 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 89.82 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 89.77 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 89.76 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 89.75 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 89.74 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 89.67 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 89.62 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 89.61 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 89.59 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 89.55 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 89.49 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 89.47 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 89.47 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 89.47 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 89.45 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 89.44 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 89.42 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 89.42 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 89.37 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 89.28 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 89.24 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 89.24 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 89.22 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 89.18 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 89.1 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 89.1 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 89.09 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 89.08 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 89.01 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 89.0 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 88.97 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 88.91 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 88.9 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 88.89 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 88.87 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 88.85 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 88.85 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 88.84 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 88.81 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 88.81 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 88.77 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 88.76 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 88.75 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 88.71 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 88.7 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 88.67 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 88.65 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 88.63 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 88.62 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 88.58 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 88.57 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 88.53 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 88.52 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 88.49 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 88.48 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 88.4 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 88.38 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 88.36 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 88.34 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 88.28 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 88.24 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 88.2 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 88.19 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 88.11 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 88.09 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 88.07 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 88.06 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 88.03 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 88.02 |
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
Probab=99.79 E-value=1.9e-20 Score=200.05 Aligned_cols=189 Identities=19% Similarity=0.293 Sum_probs=135.2
Q ss_pred CcccceeeecccccCCCCcceEEeeccceEEEccCCCChhhHHHHHHhhhcCCCCCCCCCCceEeeCCCCCCCcHHHhhc
Q psy9513 2 ALLDQLHIMGIRNFPADKNRVVRFQRPLTLIVGENGCGKTTIIECIKFALTNEYPQGASSGKNFVHDPRIGKKDEASASS 81 (1491)
Q Consensus 2 ~~~~~l~i~~~~~~~~~~~~~i~f~~~~~~i~G~NGaGKStl~~~i~~~l~g~~~~~~~~g~~~~~~~~~~~~~~~~~~~ 81 (1491)
|.|.+|.|.||++|.+ ..|+|+.++++|+||||||||||++||.|+|+|. +.. ++. .. ...+
T Consensus 1 M~i~~l~i~nf~~~~~---~~i~f~~~~~~I~G~NgsGKStil~ai~~~l~g~--~~~-r~~------~~----~~~i-- 62 (203)
T 3qks_A 1 MKLERVTVKNFRSHSD---TVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWP--LRI-KDI------KK----DEFT-- 62 (203)
T ss_dssp CEEEEEEEESBTTBSS---EEEECCSEEEEEECCTTSSHHHHHHHHHHHHHTT--SCC-TTC------CH----HHHH--
T ss_pred CEEEEEEEECCcCccc---eEEEeCCCeEEEEcCCCCCHHHHHHHHHHHhcCC--ccc-ccc------cc----hhhh--
Confidence 6788999999999973 5789998899999999999999999999999983 221 221 00 0011
Q ss_pred CccccccCCCCCCccHHHHHHhhccccCCCceEEEEeEEEEeecCCccccccccceEeeecCCCcee-ee--ccccchhh
Q psy9513 82 GKNFVHDPRIGKKDETHAIVKLQCTCENNDTVCVVRSLLLSNKNGKDNCATRDTTISRKIFATGVQK-NL--GCLQQESV 158 (1491)
Q Consensus 82 ~~~~~q~~~~~~~~~~~~~v~~~~~~~~~~~~~i~r~~~~~~~~g~~~~~~~~~~~~~~~~~~g~~~-~~--~~~q~~~~ 158 (1491)
+.....+.|.+.|.+ ++..|+|.|.+.++++.+.. ... .+. .+|.+. .. ++. +++
T Consensus 63 -----------~~~~~~~~v~l~f~~-~~~~~~i~R~~~~~~~~~~~-----~~~--~~~-~~g~~~~~~~~~~~--~v~ 120 (203)
T 3qks_A 63 -----------KVGARDTYIDLIFEK-DGTKYRITRRFLKGYSSGEI-----HAM--KRL-VGNEWKHVTEPSSK--AIS 120 (203)
T ss_dssp -----------TSCSSCEEEEEEEEE-TTEEEEEEEEEECSSSCEEE-----EEE--EEE-ETTEEEESSCSSHH--HHH
T ss_pred -----------ccCCCcEEEEEEEEE-CCEEEEEEEEEEcCCCCCcc-----ceE--EEE-cCCceeeeccCChH--HHH
Confidence 111223567777874 67789999998754211110 111 222 446443 22 455 888
Q ss_pred HHhHhhhCCcHhhhhcceeeccCCCCCCCCcchhhHHHHHHhhhhhhHHHHHHHHHHhHHHHhhhhHHHHHHHHHhHh
Q psy9513 159 LEMCNLIGVSKAILNNVIFCHQENSSWPLDEGKKVKEIFDEIFDATKYNKALESIKIQRDRLRKEIPEIKAHYQATLN 236 (1491)
Q Consensus 159 ~~i~~~~g~~~~~~~~~~f~~q~e~~~~l~~~~~~k~~~~~i~g~~~~~~~~~~lk~~~d~~~k~~~~~~~~~~~~l~ 236 (1491)
..|..++| .++|.+++|++||++.+++..+++++++|+++||++.|.+..+.+++ ..++.+..++.++..+.
T Consensus 121 ~~i~~ll~--~~~f~~~~~l~Qg~~~~~l~~~~er~~~l~~i~g~~~~~~~~~~l~~----~~~~~~~~~~~l~~~~~ 192 (203)
T 3qks_A 121 AFMEKLIP--YNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSE----LKKTINNRIKEYRDILA 192 (203)
T ss_dssp HHHHHHSC--HHHHHHTTEECTTHHHHHHHCHHHHHHHHHHHTCCCTTHHHHHHHHH----HHHHHHHHHHHHHHHHH
T ss_pred HHHHHHcC--HHHhhEEEEEcCCcHHHHHhCcHHHHHHHHHHHCCHHHHHHHHHHHH----HHHHHHHHHHHHHHHHh
Confidence 88888854 58899999999999999887669999999999999999999999999 77766666655554443
|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3l51_B Structural maintenance of chromosomes protein 4; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} SCOP: d.215.1.0 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3nwc_A SMC protein; structural maintenance of chromosomes (SMC), SMC hinge domai dimerization, DNA binding, cell cycle; 1.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1gxl_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 3.0A {Thermotoga maritima} SCOP: d.215.1.1 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3l51_A Structural maintenance of chromosomes protein 2; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1gxj_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 2.0A {Thermotoga maritima} SCOP: d.215.1.1 PDB: 1gxk_A | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1491 | ||||
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-09 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-06 | |
| d1qhla_ | 222 | c.37.1.12 (A:) Cell division protein MukB {Escheri | 2e-08 | |
| g1xew.1 | 329 | c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi | 1e-07 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-07 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 7e-04 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 5e-07 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 2e-04 | |
| d1e69a_ | 308 | c.37.1.12 (A:) Smc head domain {Thermotoga maritim | 5e-06 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 6e-04 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 0.002 |
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Length = 222 | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1491 | |||
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.72 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.71 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.71 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.7 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.67 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.66 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.65 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.62 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.6 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.57 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.55 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.53 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.51 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.49 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.48 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.46 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.45 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.43 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.43 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.43 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.41 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.41 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.41 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.4 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.39 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.36 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 99.35 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.35 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.34 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.33 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 99.32 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.31 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.29 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 99.28 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.23 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.23 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.19 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.14 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.1 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 99.1 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.02 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 98.94 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 98.92 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 98.86 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 98.84 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 98.73 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 98.43 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 98.16 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 97.85 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.67 | |
| d1gxja_ | 161 | Smc hinge domain {Thermotoga maritima [TaxId: 2336 | 96.72 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.55 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 96.25 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 95.76 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 95.47 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.43 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.35 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.34 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.21 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.08 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.06 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 94.97 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.89 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.88 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 94.86 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 94.84 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.78 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 94.75 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 94.74 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 94.68 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 94.64 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.62 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.54 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.39 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.33 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 94.29 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 94.29 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 94.28 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.26 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 94.25 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 94.19 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.1 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 94.09 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.02 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 93.99 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 93.76 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 93.68 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 93.48 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 93.42 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 93.29 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 93.28 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 93.22 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 93.2 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 93.12 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 93.11 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 93.11 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.1 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 93.08 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.07 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 93.04 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.03 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 93.0 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.98 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 92.9 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 92.82 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 92.71 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 92.69 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 92.69 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 92.64 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 92.61 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 92.58 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 92.57 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 92.55 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 92.53 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 92.5 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 92.48 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 92.47 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 92.34 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 92.27 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 92.25 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 92.05 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 91.82 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.82 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 91.66 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 91.55 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 91.43 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 91.41 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 91.37 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 91.29 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 91.19 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 91.14 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 91.07 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 91.05 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.95 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 90.94 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 90.93 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.89 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 90.58 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 90.56 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 90.53 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 90.4 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 90.34 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 90.3 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 90.27 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 90.23 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 90.14 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 90.14 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 90.13 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 90.1 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 90.06 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 90.02 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 89.98 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 89.93 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 89.85 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 89.83 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 89.8 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 89.68 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 89.65 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 89.58 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 89.43 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 89.41 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 89.35 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 89.28 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 89.17 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 89.08 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 89.06 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 89.05 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 88.99 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 88.94 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 88.88 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 88.73 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 88.73 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 88.73 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 88.55 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 88.52 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 88.45 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 88.3 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 87.97 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 87.97 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 87.94 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 87.93 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 87.91 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 87.79 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 87.78 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 87.78 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 87.77 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.64 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 87.41 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 87.36 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 87.29 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 87.27 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 87.21 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 87.14 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 87.11 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 87.07 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 87.0 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 86.97 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 86.8 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 86.79 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 86.62 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 86.39 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 86.36 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 86.34 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 86.33 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 86.28 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 86.27 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 86.27 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 86.19 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 86.12 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 86.04 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 85.88 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 85.85 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 85.81 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 85.71 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 85.66 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 85.44 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 85.31 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 85.16 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 85.1 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 84.91 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 84.61 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 84.56 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 84.49 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 84.33 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 84.21 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 84.02 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 83.79 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 83.76 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 83.55 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 83.11 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 82.85 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 82.54 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 82.47 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 82.39 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 82.19 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 82.07 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 82.02 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 81.24 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 80.85 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 80.47 |
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: MJ0796 species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Probab=99.72 E-value=2.8e-18 Score=179.66 Aligned_cols=126 Identities=17% Similarity=0.226 Sum_probs=102.4
Q ss_pred CCcccceeEEEEe--ccc---cccccccccchhhHHHHHHHHHHhhhhcccceEEEEccchhhhhhhhhHHHH-hHHHH-
Q psy9513 1171 EKRRTYNYRVVQK--KNG---IEQDMRNRCSAGQRVLACLIIRLFISDQKNFQLIVITHDEEFIENLTAIDRA-YVVRI- 1243 (1491)
Q Consensus 1171 ~~~~~yn~~~~~~--~~~---~~~~~~~~~~~~~~~~~~~ii~~~~~~~~n~~l~~i~~~~~~~~~L~~~~~~-~~~~l- 1243 (1491)
+..+||=++++++ +|+ +.+|+.++.......+ +.+|++ .+|||||++.+++.+++.+|+ ++..+
T Consensus 41 GsGKSTLl~~i~gl~~p~sG~I~~~g~~i~~~~~~~~-----~~~r~~----~ig~v~Q~~~l~~~~tv~eni~~~~~~~ 111 (230)
T d1l2ta_ 41 GSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDEL-----TKIRRD----KIGFVFQQFNLIPLLTALENVELPLIFK 111 (230)
T ss_dssp TSSHHHHHHHHTTSSCCSEEEEEETTEECTTCCHHHH-----HHHHHH----HEEEECTTCCCCTTSCHHHHHHHHHHTC
T ss_pred CCCcchhhHhccCCCCCCcceeEECCEEcCcCChhhc-----chhhcc----eEEEEecchhhCcCccHHHHHhHHHHHh
Confidence 3467777877777 443 8889998888877665 222332 499999999999999999986 33211
Q ss_pred --------------------------------------hhhHHHHHHHhhcCCCeeEEcCCCCCCChHhH---------H
Q psy9513 1244 --------------------------------------VRDHKALAETFSRNCGIFALDEPTTNLDIKNA---------S 1276 (1491)
Q Consensus 1244 --------------------------------------~~~~~~~a~~~~~~~~~l~lDEp~~~lD~~~~---------~ 1276 (1491)
++|||+|||||+.+|++|+|||||+|||+.+. .
T Consensus 112 ~~~~~~~~~~~~~~~~~l~~~~L~~~~~~~~p~~LSGGqkQRvaIAraL~~~P~lLllDEPTs~LD~~~~~~i~~~l~~l 191 (230)
T d1l2ta_ 112 YRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKL 191 (230)
T ss_dssp CSSCCCHHHHHHHHHHHHHHTTCCGGGTTCCGGGSCHHHHHHHHHHHHHTTCCSEEEEESTTTTSCHHHHHHHHHHHHHH
T ss_pred ccCCCCHHHHHHHHHHHHHhhchhhhhhcCChhhCCHHHHHHHHHHhhhhcCCCEEEecCCccccCHHHHHHHHHHHHHH
Confidence 68999999999999999999999999999998 2
Q ss_pred -hhcCceEEEEccCHHHHHHHhccccceEEEEecC
Q psy9513 1277 -DQKNFQLIVITHDEEFIENLTAIDRAYVVRIVRD 1310 (1491)
Q Consensus 1277 -~~~~~~~i~~thd~~~~~~~~~~~~~~~~~l~~~ 1310 (1491)
...|.|+|+||||++++ .+| |++++|.+|
T Consensus 192 ~~~~g~tii~vTHd~~~a-~~~----drv~~m~~G 221 (230)
T d1l2ta_ 192 NEEDGKTVVVVTHDINVA-RFG----ERIIYLKDG 221 (230)
T ss_dssp HHTTCCEEEEECSCHHHH-TTS----SEEEEEETT
T ss_pred HHhhCCEEEEECCCHHHH-HhC----CEEEEEECC
Confidence 34589999999999987 689 999999988
|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|