Diaphorina citri psyllid: psy9514

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-
MDASGVAKIKQEFIVEDHVKVLSIECVNETDKRKLEELEVEDDGTAKKKFKKNKQVLKGQNKARGPTFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTYNFEKSEKICKENKASKNENKDTDDCCKNQDSKVIEGREEINTPNTDDVIKVQEETKSGPVLDTDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRYP
cccccccccccccEEccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccEEccccccccccEEEcccccccccccccccHHHHHHHHHcccccccccccHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEcccccHHHHcccHHHHHHHHHcccccccCEEcccccHHHHHHHHHHHHHHccccEEEEcccccHHHHHcccccccccccccccEEEcccccHHHHHHHHHHHHHHHcccEEEEccccccCEEEccccccccccHHHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHccccccHHHccccccHHHHHHHHcccccccEEEccccccHHHHHHHHHccccccEEEEcccccccccHHHHHHHHccccccccccccccc
*****VAKIKQEFIVE**************************************************TFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTYNFEKSEK*******************************************************TDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRYP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDASGVAKIKQEFIVEDHVKVLSIECVNETDKRKLEELEVEDDGTAKKKFKKNKQVLKGQNKARGPTFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTYNFEKSEKICKENKASKNENKDTDDCCKNQDSKVIEGREEINTPNTDDVIKVQEETKSGPVLDTDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRYP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs. Specifically modifies U47 in cytoplasmic tRNAs.confidentQ06053
tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs. Specifically modifies U47 in cytoplasmic tRNAs.confidentQ6C4K3
tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.confidentQ96G46

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B0P, chain A
Confidence level:very confident
Coverage over the Query: 257-314,370-479,532-598
View the alignment between query and template
View the model in PyMOL
Template: 2HSA, chain B
Confidence level:confident
Coverage over the Query: 246-488,512,531-604
View the alignment between query and template
View the model in PyMOL
Template: 1M9O, chain A
Confidence level:confident
Coverage over the Query: 72-106
View the alignment between query and template
View the model in PyMOL
Template: 3TJX, chain A
Confidence level:confident
Coverage over the Query: 249-301,312-337,363-404,419-481,512-596
View the alignment between query and template
View the model in PyMOL
Template: 3VKJ, chain A
Confidence level:confident
Coverage over the Query: 250-318,347-348,371-514,532-585
View the alignment between query and template
View the model in PyMOL