Psyllid ID: psy9514

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-
MDASGVAKIKQEFIVEDHVKVLSIECVNETDKRKLEELEVEDDGTAKKKFKKNKQVLKGQNKARGPTFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTYNFEKSEKICKENKASKNENKDTDDCCKNQDSKVIEGREEINTPNTDDVIKVQEETKSGPVLDTDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRYP
cccccccccccccEEcccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccEEccccccccccEEEcccccccccccccccHHHHHHHHHcccccccccccHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEcccccHHHHcccHHHHHHHHHcccccccEEEcccccHHHHHHHHHHHHHHccccEEEEcccccHHHHHcccccccccccccccEEEcccccHHHHHHHHHHHHHHHcccEEEEccccccEEEEccccccccccHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHccccccHHHccccccHHHHHHHHHccccccEEEccccccHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHccccccccccccccc
ccccccccccHHEEcccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccHHHHcccHHHccccccccccccccccEEccHHHHHHHccccccccccEEEccccccccEEEEEccccccccccccccHHHHHHcccccccccEccccHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccEcccccEEEEcccccccHHHHHHHHHHcccEEEcHHHHcHHHHccccHHHHHHHHccccccccEEEccccHHHHHHHHHHHHccccccEEEEcccccHHHEEEcccccHHcccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEcccccccHEEccccHHHHHHcHHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHcccEEEEEEcccHHHHccccccHHHHHHHHHHccccccccccccccHccHHHHHccccccEEEEEcccHccccccccccccccccEEEEccccccHHHHHHHHHccccccEEEEEHHHccccHHHHHHHHccccccccEEEEEccc
MDASGVAKIKQEFIVEDHVKVLSIECVNetdkrkleeleveddgtakkKFKKNKQvlkgqnkargptfvtkpedcycpflkdstleqtckygekckfvhdknvfmkskpedisEQCYVFLqhgycpmgiacrfgsshldenggnivkEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTYNFEKSEKICKENkasknenkdtddccknqdskviegreeintpntddVIKVQeetksgpvldtdIIKIKNSekkkidwqgklylsplttvgnlpfRRLCKkwgaditcSEMAVATELLKSSPQEWALIKRhesedlfgvqlcgnnpyvLTKCTQLLEEQMAVDfvdvnlgcpiefiykqgsgsgllqranlfgvqlcgnnpyvLTKCTQLLEEQMVVDFvdvnlgcpiefiykqgsgsgllQRANILQSVITCMNevsslpitvktrtgihkdnniihnfmpkfrDWGASLITLhgrtreqrytKQADWDYIEKCAQLCsrdnniihnfmpkfRDWGASLITLhgrtreqrytKQADWDYIEKCAqlcspaplygngdilsyedyteslkkspsisgvmigrgalikpwiFQEIKEKKLFDIYAIVWKWRYP
mdasgvakikqefivedhvkvlsiecvnetdkrkleeleveddgtakkkfkknkqvlkgqnkargptfvtkpedcYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTvgnktvnmlanevrqdlrkhtynfeksekickenkasknenkdtddccknqdskviegreeintpntddvikvqeetksgpvldtdiikiknsekkkidwqgklylsplttvgnlpFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPItvktrtgihkdnniiHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPwifqeikekklFDIYAIVWKWRYP
MDASGVAKIKQEFIVEDHVKVLSIECVNETDKRKLEELEVEDDGTAkkkfkknkqvlkGQNKARGPTFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTYNFEKSEKICKENKASKNENKDTDDCCKNQDSKVIEGREEINTPNTDDVIKVQEETKSGPVLDTDiikiknsekkkiDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRYP
*******KIKQEFIVEDHVKVLSIECVN**************************************TFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTY***********************************************************VLDTDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRY*
*DASGVAKIKQEFIV*************************************************************CPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHL************************VNMLANEVRQDLRKHTYNFEKSEK********************************************************************IDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELL**********KRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRYP
********IKQEFIVEDHVKVLSIECVNETDKRKLEELEVEDDGTAKKKFKKNKQVLKGQNKARGPTFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTYNFEKSEKICKEN*************CKNQDSKVIEGREEINTPNTDDVIKVQEETKSGPVLDTDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRYP
*****VAK*****I*E*************************************************PTFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTYNFEKSEKICKENKAS***********************************************TDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTK*A*******CAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRYP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDASGVAKIKQEFIVEDHVKVLSIECVNETDKRKLEELEVEDDGTAKKKFKKNKQVLKGQNKARGPTFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKHTYNFEKSEKICKENKASKNENKDTDDCCKNQDSKVIEGREEINTPNTDDVIKVQEETKSGPVLDTDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIVWKWRYP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query611 2.2.26 [Sep-21-2011]
Q28BT8639 tRNA-dihydrouridine(47) s yes N/A 0.720 0.688 0.384 1e-102
Q7ZWS1640 tRNA-dihydrouridine(47) s N/A N/A 0.702 0.670 0.385 1e-101
Q96G46650 tRNA-dihydrouridine(47) s yes N/A 0.743 0.698 0.340 5e-96
Q91XI1637 tRNA-dihydrouridine(47) s yes N/A 0.707 0.678 0.350 3e-94
Q3KRC5640 tRNA-dihydrouridine(47) s yes N/A 0.708 0.676 0.338 7e-92
A8NZY7 676 tRNA-dihydrouridine(47) s N/A N/A 0.682 0.616 0.312 1e-72
Q9T0J6 691 tRNA-dihydrouridine(47) s yes N/A 0.690 0.610 0.306 1e-69
P0CN29 725 tRNA-dihydrouridine(47) s N/A N/A 0.826 0.696 0.276 6e-63
P0CN28 725 tRNA-dihydrouridine(47) s yes N/A 0.826 0.696 0.276 8e-63
Q9UTH9 617 tRNA-dihydrouridine(47) s yes N/A 0.757 0.750 0.303 2e-62
>sp|Q28BT8|DUS3L_XENTR tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Xenopus tropicalis GN=dus3l PE=2 SV=2 Back     alignment and function desciption
 Score =  373 bits (957), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 217/565 (38%), Positives = 298/565 (52%), Gaps = 125/565 (22%)

Query: 39  EVEDDGTAKKKFKKNKQVLKGQNKARGPTFVTK-PEDCYCPFLKDSTLEQTCKYGEKCKF 97
           E +D      + K+ K+  +GQNK+R     ++  E+  CP +      + C +G+KCKF
Sbjct: 89  EGQDKPPTSAENKQEKKRARGQNKSRPHMKHSQFEENKLCPSVTQECASK-CFFGDKCKF 147

Query: 98  VHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNT 157
           +HD   ++  KPEDI   CY++   G C  G+ CRF  SHL +N  N++ E+++K+W+  
Sbjct: 148 LHDVAKYVSEKPEDIRPNCYLYETFGKCIYGVTCRFAKSHLGDNFKNLINEELMKQWEGQ 207

Query: 158 VGNKTVNMLANEVRQDLRKHTYNFEKSEKICKENKASKNENKDTDDCCKNQDSKVIEGRE 217
           V  K  N L   +++ LRK    FEK++K  K              C K+ DS  I+   
Sbjct: 208 VLVK--NSLDKSLKEQLRKRKVVFEKTDKYLKL-------------CNKSGDSLKIKS-P 251

Query: 218 EINTPNTDDVI-KVQEETKSGPVLDTDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRR 276
            +   N   V+ K    T  G V D D++K++  EKK ID++ KLYL+PLTT GNLPFRR
Sbjct: 252 VVKEDNAAQVVQKDSPVTTVGAVTDEDLVKLRPCEKKTIDFRNKLYLAPLTTCGNLPFRR 311

Query: 277 LCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLE 336
           LCK++GADITC EMA+ T LL+  P EWAL+KRH SED+FGVQL G  P  +TKC +LL 
Sbjct: 312 LCKRFGADITCGEMAMCTNLLQGQPSEWALLKRHHSEDIFGVQLEGAFPDTMTKCAELLN 371

Query: 337 EQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVV 396
             + VDFVD+N+GCPI+ +YK+G G GL+ R N F                    EQ+V 
Sbjct: 372 RTIDVDFVDINVGCPIDLVYKKGGGCGLMNRTNKF--------------------EQIV- 410

Query: 397 DFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNII 456
                                               MN V  +P+TVK RTG+ +  NI 
Sbjct: 411 ----------------------------------KGMNSVLDVPLTVKIRTGVQEKINIA 436

Query: 457 HNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWG 516
           H  +P  RDWG SL+TLHGR+REQRYTK ADW+YI +CA +                   
Sbjct: 437 HKLIPNLRDWGVSLVTLHGRSREQRYTKLADWEYIAQCADI------------------- 477

Query: 517 ASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISG 576
                                          SP PL+GNGDI+SYED   +L+    +SG
Sbjct: 478 ------------------------------ASPLPLFGNGDIISYEDANRALQT--GVSG 505

Query: 577 VMIGRGALIKPWIFQEIKEKKLFDI 601
           +M+ RGAL+KPW+F EIKE++ +DI
Sbjct: 506 IMLARGALLKPWLFTEIKEQRHWDI 530
Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.
Xenopus tropicalis (taxid: 8364)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|Q7ZWS1|DUS3L_XENLA tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Xenopus laevis GN=dus3l PE=2 SV=1 Back     alignment and function description
>sp|Q96G46|DUS3L_HUMAN tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS3L PE=1 SV=2 Back     alignment and function description
>sp|Q91XI1|DUS3L_MOUSE tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus3l PE=2 SV=1 Back     alignment and function description
>sp|Q3KRC5|DUS3L_RAT tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus3l PE=2 SV=1 Back     alignment and function description
>sp|A8NZY7|DUS3_COPC7 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=DUS3 PE=3 SV=1 Back     alignment and function description
>sp|Q9T0J6|DUS3L_ARATH tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Arabidopsis thaliana GN=At4g38890 PE=2 SV=2 Back     alignment and function description
>sp|P0CN29|DUS3_CRYNB tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DUS3 PE=3 SV=1 Back     alignment and function description
>sp|P0CN28|DUS3_CRYNJ tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DUS3 PE=3 SV=1 Back     alignment and function description
>sp|Q9UTH9|DUS3_SCHPO tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query611
350411344651 PREDICTED: tRNA-dihydrouridine synthase 0.801 0.752 0.424 1e-131
340729664651 PREDICTED: LOW QUALITY PROTEIN: tRNA-dih 0.808 0.758 0.425 1e-129
380017191642 PREDICTED: tRNA-dihydrouridine(47) synth 0.797 0.758 0.432 1e-127
307203528660 tRNA-dihydrouridine synthase 3-like [Har 0.805 0.745 0.401 1e-127
328778500642 PREDICTED: tRNA-dihydrouridine synthase 0.797 0.758 0.428 1e-126
332028941665 tRNA-dihydrouridine synthase 3-like prot 0.803 0.738 0.401 1e-125
383851178640 PREDICTED: tRNA-dihydrouridine(47) synth 0.795 0.759 0.416 1e-122
307171073592 tRNA-dihydrouridine synthase 3-like [Cam 0.797 0.822 0.405 1e-121
193636409578 PREDICTED: tRNA-dihydrouridine synthase 0.713 0.754 0.387 1e-109
357605297588 putative dihydrouridine synthase 3-like 0.767 0.797 0.382 1e-108
>gi|350411344|ref|XP_003489316.1| PREDICTED: tRNA-dihydrouridine synthase 3-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 268/631 (42%), Positives = 360/631 (57%), Gaps = 141/631 (22%)

Query: 5   GVAKIKQEFIVEDHVKVLSIECVNETDKRKL--------EELEVEDDGTAKK-KFKKNKQ 55
           GV  IK+EFI+EDHV++LS +C+ ETDK+K+        E++ + D+   KK K    K+
Sbjct: 23  GVCLIKEEFIIEDHVRLLSEKCLTETDKQKVSNNTTNLSEDVSILDEPPTKKLKNDDKKE 82

Query: 56  VLKGQNKARGPTFVTKPEDCYCPFLKDSTL---EQTCKYGEKCKFVHDKNVFMKSKPEDI 112
            L+GQNKAR P F T+ E   CP++ D  +   E+ C    +C F+H++  ++K KP+DI
Sbjct: 83  KLRGQNKARPPPFKTQRELNLCPWVADQAVDEPERKCD-NNQCIFLHNRVEYLKIKPDDI 141

Query: 113 SEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQ 172
           +++CY+F   G CP G ACR GS HL + G NI+ ++ + E++    + T N LA +++ 
Sbjct: 142 TDECYIFELTGRCPRGAACRMGSKHLTKEGLNIIDKEKMDEFRKRPPS-TKNHLAKDIQT 200

Query: 173 DLRKHTYNFEKSEKICKENKASK--------------------NENKDTDDCCKNQDSKV 212
            LRKH YNF KSE I K N  S+                    +E+ D D   + +DS +
Sbjct: 201 QLRKHKYNFSKSENIVKANGPSRKNIGTKKVKQEPEIEKIKQIDESLDRDKL-EAKDSPI 259

Query: 213 IEGREEINTPNTDDVIKVQEETKSGPVLDTDIIKIKNSEKKKIDWQGKLYLSPLTTVGNL 272
           ++    IN            E K GP+ D D+IK ++SEKKKIDW+ K+ LSPLTTVGNL
Sbjct: 260 LDT--SINESKNKAPETQNTEKKLGPIEDYDLIKCRDSEKKKIDWRNKILLSPLTTVGNL 317

Query: 273 PFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCT 332
           PFRR+CK++GADITC EMA+A  +LK + +EWAL+KRHESED+FGVQLCGNNP VLT+C 
Sbjct: 318 PFRRICKEYGADITCGEMALAPRILKGAHEEWALVKRHESEDIFGVQLCGNNPGVLTRCA 377

Query: 333 QLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEE 392
           QLL E++ +DF+D+NLGCPI+ IY+QG GSG+L R N+                      
Sbjct: 378 QLLNEEIDIDFIDLNLGCPIDLIYRQGGGSGMLNRLNVL--------------------- 416

Query: 393 QMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKD 452
                                           +++SV    N+V ++P+TVKTRTG++ D
Sbjct: 417 ------------------------------ETVVKSV----NQVMNIPLTVKTRTGVYID 442

Query: 453 NNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKF 512
             I H  MPKFRDWG S+IT+HGR+REQRYTK ADWDYIEKCA+                
Sbjct: 443 KPIAHTLMPKFRDWGVSMITVHGRSREQRYTKLADWDYIEKCAK---------------- 486

Query: 513 RDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSP 572
                                            L  P P++GNGDILSY+DY        
Sbjct: 487 ---------------------------------LADPIPVFGNGDILSYDDYRRVQDAYT 513

Query: 573 SISGVMIGRGALIKPWIFQEIKEKKLFDIYA 603
           SI G+ IGRGALIKPWIF EIKEKKL DI +
Sbjct: 514 SIYGITIGRGALIKPWIFTEIKEKKLIDISS 544

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340729664|ref|XP_003403117.1| PREDICTED: LOW QUALITY PROTEIN: tRNA-dihydrouridine synthase 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380017191|ref|XP_003692544.1| PREDICTED: tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like [Apis florea] Back     alignment and taxonomy information
>gi|307203528|gb|EFN82561.1| tRNA-dihydrouridine synthase 3-like [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328778500|ref|XP_393458.4| PREDICTED: tRNA-dihydrouridine synthase 3-like [Apis mellifera] Back     alignment and taxonomy information
>gi|332028941|gb|EGI68959.1| tRNA-dihydrouridine synthase 3-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383851178|ref|XP_003701116.1| PREDICTED: tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307171073|gb|EFN63116.1| tRNA-dihydrouridine synthase 3-like [Camponotus floridanus] Back     alignment and taxonomy information
>gi|193636409|ref|XP_001949454.1| PREDICTED: tRNA-dihydrouridine synthase 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357605297|gb|EHJ64545.1| putative dihydrouridine synthase 3-like protein [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query611
FB|FBgn0032819604 CG10463 [Drosophila melanogast 0.585 0.592 0.389 3.7e-99
ZFIN|ZDB-GENE-040426-1260660 dus3l "dihydrouridine synthase 0.772 0.715 0.306 5.5e-92
UNIPROTKB|Q96G46650 DUS3L "tRNA-dihydrouridine(47) 0.518 0.487 0.378 8e-91
UNIPROTKB|F1SBU5652 LOC100513458 "Uncharacterized 0.507 0.475 0.383 1.3e-90
UNIPROTKB|E1BGZ1650 DUS3L "Uncharacterized protein 0.587 0.552 0.354 1.9e-89
UNIPROTKB|F1PS34645 LOC100856098 "Uncharacterized 0.509 0.482 0.368 6.3e-89
MGI|MGI:2147092637 Dus3l "dihydrouridine synthase 0.502 0.481 0.381 2.7e-88
RGD|1563228640 Dus3l "dihydrouridine synthase 0.517 0.493 0.367 1e-86
UNIPROTKB|F1NGP4630 DUS3L "Uncharacterized protein 0.343 0.333 0.407 6.4e-72
WB|WBGene00021377554 Y37E11B.5 [Caenorhabditis eleg 0.188 0.207 0.517 1.5e-64
FB|FBgn0032819 CG10463 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 663 (238.4 bits), Expect = 3.7e-99, Sum P(2) = 3.7e-99
 Identities = 148/380 (38%), Positives = 218/380 (57%)

Query:     1 MDASGVAKIKQEFIVE--DHVKVLSIECVNETDKRKLEEL-EVEDDGTAXXXXXXXXXXX 57
             MD SG+  IK E++V   D     +    ++T+KRK EE  EVE                
Sbjct:     1 MD-SGICYIKPEYLVTEADGGSAAANTENSDTNKRKREEGGEVE---AGEKRKWDKKERK 56

Query:    58 XGQNKARGPTFVTKPEDCYCPFLKDSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCY 117
              GQNK R P F  +     C  L D T  + C     C++VHD + ++ +K ED+  +CY
Sbjct:    57 RGQNKNR-PVFKDERYSHLCHSLIDGTGGEPCSLAN-CRYVHDLDAYLAAKGEDLGPECY 114

Query:   118 VFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNKTVNMLANEVRQDLRKH 177
             V+   GYC  G++CRF  +H DE G N+ +ED  ++   T    T N +++E++  LRKH
Sbjct:   115 VYTTKGYCARGVSCRFAKAHTDEQGRNLKREDYDEKAPPT----TCNGVSSELQVRLRKH 170

Query:   178 TYNFEKSEKICKENKASKNENKDTDDCCKNQDSKVIEGREEINTPNTDDVIKVQEET--K 235
              Y+F +S+++ K  +  ++  K  +   + ++  + E   E     T +++  +++T  K
Sbjct:   171 EYDFSRSKELIKMAEKLRDARKLMEQ--QEKEKNLSEETGEKQPSETTEILDAEKQTDSK 228

Query:   236 SGPV-----LDTDXXXXXXXXXXXXDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEM 290
             S P      +D              D++ KL LSPLTT+GNLPFRR+CK++GADITC EM
Sbjct:   229 SKPTATGCAIDDSAIGRDADHKPAVDFREKLVLSPLTTLGNLPFRRICKEFGADITCGEM 288

Query:   291 AVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGC 350
             A A  LLK   QEWAL KRH+SED+FGVQLCGNNP +L +  Q++ E   VDF+D+N+GC
Sbjct:   289 ACAQPLLKGMGQEWALTKRHQSEDVFGVQLCGNNPNMLNQAAQVIHETAQVDFIDLNIGC 348

Query:   351 PIEFIYKQGSGSGLLQRANL 370
             PI+ IY+QG GS L++R N+
Sbjct:   349 PIDLIYQQGGGSALMRRTNI 368
GO:0008033 "tRNA processing" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0017150 "tRNA dihydrouridine synthase activity" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
ZFIN|ZDB-GENE-040426-1260 dus3l "dihydrouridine synthase 3-like (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96G46 DUS3L "tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBU5 LOC100513458 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGZ1 DUS3L "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PS34 LOC100856098 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2147092 Dus3l "dihydrouridine synthase 3-like (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1563228 Dus3l "dihydrouridine synthase 3-like (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGP4 DUS3L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00021377 Y37E11B.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6C4K3DUS3_YARLI1, ., 3, ., 1, ., 8, 90.30050.66610.6543yesN/A
Q91XI1DUS3L_MOUSE1, ., 3, ., 1, ., -0.35030.70700.6781yesN/A
Q28BT8DUS3L_XENTR1, ., 3, ., 1, ., -0.38400.72010.6885yesN/A
Q96G46DUS3L_HUMAN1, ., 3, ., 1, ., -0.34000.74300.6984yesN/A
Q9T0J6DUS3L_ARATH1, ., 3, ., 1, ., -0.30630.69060.6107yesN/A
Q3KRC5DUS3L_RAT1, ., 3, ., 1, ., -0.33820.70860.6765yesN/A
Q06053DUS3_YEAST1, ., 3, ., 1, ., 8, 90.30460.81830.7485yesN/A
A3LUK5DUS3_PICST1, ., 3, ., 1, ., 8, 90.30110.66930.6672yesN/A
Q6FJ14DUS3_CANGA1, ., 3, ., 1, ., 8, 90.30690.68900.6578yesN/A
Q9UTH9DUS3_SCHPO1, ., 3, ., 1, ., 8, 90.30350.75770.7504yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query611
cd02801231 cd02801, DUS_like_FMN, Dihydrouridine synthase-lik 3e-83
COG0042323 COG0042, COG0042, tRNA-dihydrouridine synthase [Tr 2e-47
TIGR00737319 TIGR00737, nifR3_yhdG, putative TIM-barrel protein 6e-45
pfam01207309 pfam01207, Dus, Dihydrouridine synthase (Dus) 2e-36
PRK10415321 PRK10415, PRK10415, tRNA-dihydrouridine synthase B 3e-19
TIGR00742318 TIGR00742, yjbN, tRNA dihydrouridine synthase A 7e-11
PRK10550312 PRK10550, PRK10550, tRNA-dihydrouridine synthase C 1e-07
PRK11815333 PRK11815, PRK11815, tRNA-dihydrouridine synthase A 5e-06
>gnl|CDD|239200 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information 
 Score =  260 bits (666), Expect = 3e-83
 Identities = 99/336 (29%), Positives = 144/336 (42%), Gaps = 108/336 (32%)

Query: 260 KLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQ 319
           KL L+P+  V +LPFR LC+++GAD+  +EM  A  LL+ + +   L+ R+  E    VQ
Sbjct: 1   KLILAPMVGVTDLPFRLLCRRYGADLVYTEMISAKALLRGNRKRLRLLTRNPEERPLIVQ 60

Query: 320 LCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNN 379
           L G++P  L +  +++EE          LG                              
Sbjct: 61  LGGSDPETLAEAAKIVEE----------LGA----------------------------- 81

Query: 380 PYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSSL 439
                            D +D+N+GCP   + K G+G+ LL+   ++  ++  + E   +
Sbjct: 82  -----------------DGIDLNMGCPSPKVTKGGAGAALLKDPELVAEIVRAVREAVPI 124

Query: 440 PITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCS 499
           P+TVK R G                                       WD          
Sbjct: 125 PVTVKIRLG---------------------------------------WD---------- 135

Query: 500 RDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDIL 559
            D            D GAS +T+HGRTREQRY+  ADWDYI +  +  S  P+  NGDI 
Sbjct: 136 -DEEETLELAKALEDAGASALTVHGRTREQRYSGPADWDYIAEIKEAVSI-PVIANGDIF 193

Query: 560 SYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKE 595
           S ED    L+++  + GVMIGRGAL  PW+F+EIKE
Sbjct: 194 SLEDALRCLEQT-GVDGVMIGRGALGNPWLFREIKE 228

Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. 1VHN, a putative flavin oxidoreductase, has high sequence similarity to DUS. The enzymatic mechanism of 1VHN is not known at the present. Length = 231
>gnl|CDD|223120 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129820 TIGR00737, nifR3_yhdG, putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>gnl|CDD|216365 pfam01207, Dus, Dihydrouridine synthase (Dus) Back     alignment and domain information
>gnl|CDD|182440 PRK10415, PRK10415, tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|129825 TIGR00742, yjbN, tRNA dihydrouridine synthase A Back     alignment and domain information
>gnl|CDD|236713 PRK10550, PRK10550, tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>gnl|CDD|236991 PRK11815, PRK11815, tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 611
KOG2333|consensus614 100.0
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 100.0
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 100.0
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 100.0
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 100.0
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 100.0
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 100.0
KOG2335|consensus358 100.0
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 100.0
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 100.0
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 100.0
PRK13523337 NADPH dehydrogenase NamA; Provisional 100.0
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 100.0
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 100.0
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 100.0
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 100.0
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 100.0
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 100.0
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 100.0
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 100.0
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 100.0
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 100.0
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 99.98
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 99.98
PRK10605362 N-ethylmaleimide reductase; Provisional 99.97
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 99.97
PLN02411391 12-oxophytodienoate reductase 99.97
KOG2334|consensus 477 99.97
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 99.97
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 99.96
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 99.96
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 99.96
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 99.95
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 99.94
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 99.94
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 99.93
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 99.9
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 99.9
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 99.89
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 99.87
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 99.85
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 99.83
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 99.81
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 99.8
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 99.8
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 99.76
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 99.75
PLN02826409 dihydroorotate dehydrogenase 99.72
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 99.62
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 99.61
PRK14024241 phosphoribosyl isomerase A; Provisional 99.6
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.58
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 99.58
KOG0134|consensus400 99.54
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 99.5
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.26
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 99.24
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 99.23
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.21
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 99.19
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 99.17
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 99.14
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 99.13
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 99.11
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.09
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 99.07
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 99.05
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 99.01
KOG2333|consensus614 99.0
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 98.99
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 98.98
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 98.96
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 98.95
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 98.91
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 98.86
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 98.86
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 98.85
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 98.85
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 98.81
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 98.79
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 98.78
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 98.71
PRK02083 253 imidazole glycerol phosphate synthase subunit HisF 98.71
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 98.69
cd04731 243 HisF The cyclase subunit of imidazoleglycerol phos 98.69
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 98.68
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 98.67
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 98.65
TIGR01304 369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 98.57
cd04732 234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 98.55
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.55
TIGR00735 254 hisF imidazoleglycerol phosphate synthase, cyclase 98.51
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.5
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 98.5
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.44
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 98.43
KOG1799|consensus471 98.42
KOG1677|consensus332 98.42
KOG1436|consensus398 98.39
PRK08649 368 inosine 5-monophosphate dehydrogenase; Validated 98.39
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 98.37
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 98.35
PRK00208250 thiG thiazole synthase; Reviewed 98.33
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 98.32
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 98.31
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 98.25
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 98.25
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 98.22
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 98.19
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 98.18
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 98.16
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 98.16
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 98.13
PLN02979366 glycolate oxidase 98.11
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.06
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.05
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 98.04
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 98.04
KOG2334|consensus477 98.03
PLN02535364 glycolate oxidase 98.03
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 98.02
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 98.02
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 98.02
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 98.01
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 98.0
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 97.99
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 97.96
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.96
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.96
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 97.96
PF01645368 Glu_synthase: Conserved region in glutamate syntha 97.95
PRK13585 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.94
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 97.91
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 97.9
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 97.86
PRK05581220 ribulose-phosphate 3-epimerase; Validated 97.81
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.81
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 97.8
PRK11197381 lldD L-lactate dehydrogenase; Provisional 97.79
PLN02274505 inosine-5'-monophosphate dehydrogenase 97.78
PRK00507221 deoxyribose-phosphate aldolase; Provisional 97.77
KOG2335|consensus 358 97.75
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 97.73
PLN02617538 imidazole glycerol phosphate synthase hisHF 97.71
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 97.71
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 97.7
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 97.69
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 97.69
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 97.69
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.66
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 97.65
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 97.64
PRK14024 241 phosphoribosyl isomerase A; Provisional 97.63
PRK01033 258 imidazole glycerol phosphate synthase subunit HisF 97.62
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 97.61
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 97.61
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 97.59
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 97.58
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 97.56
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 97.56
COG0107 256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.55
KOG1606|consensus296 97.55
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.53
PLN02334229 ribulose-phosphate 3-epimerase 97.52
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.49
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.49
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 97.48
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 97.47
PLN02591250 tryptophan synthase 97.46
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 97.46
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 97.46
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.45
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 97.44
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 97.44
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 97.44
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 97.39
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 97.35
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.32
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 97.31
PRK04302223 triosephosphate isomerase; Provisional 97.26
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 97.26
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.25
TIGR02129 253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.24
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 97.21
PRK14114 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.2
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 97.19
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 97.16
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 97.13
PRK07695201 transcriptional regulator TenI; Provisional 97.13
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 97.13
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 97.12
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.11
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 97.09
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 97.06
TIGR01919 243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.02
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 97.0
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 96.99
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.99
cd02812219 PcrB_like PcrB_like proteins. One member of this f 96.98
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 96.97
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 96.97
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 96.96
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 96.91
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 96.91
KOG0538|consensus363 96.86
PLN02446 262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 96.85
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 96.84
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 96.8
COG0106 241 HisA Phosphoribosylformimino-5-aminoimidazole carb 96.8
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 96.8
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 96.78
PRK05283257 deoxyribose-phosphate aldolase; Provisional 96.77
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 96.76
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.73
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 96.73
PLN02617 538 imidazole glycerol phosphate synthase hisHF 96.65
PLN02460338 indole-3-glycerol-phosphate synthase 96.61
smart0035627 ZnF_C3H1 zinc finger. 96.59
PRK07226267 fructose-bisphosphate aldolase; Provisional 96.55
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 96.55
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 96.55
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 96.54
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 96.53
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.52
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 96.51
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 96.49
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.49
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 96.4
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.36
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 96.34
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 96.31
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 96.3
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 96.28
PRK08005210 epimerase; Validated 96.27
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.24
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 96.21
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 96.17
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 96.12
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 96.1
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 96.09
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 96.08
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 96.08
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 96.05
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 96.04
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 95.99
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 95.84
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 95.84
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 95.81
PRK06806281 fructose-bisphosphate aldolase; Provisional 95.81
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 95.74
PRK11572248 copper homeostasis protein CutC; Provisional 95.71
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 95.61
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 95.6
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 95.51
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 95.44
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily o 95.4
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 95.34
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 95.33
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 95.31
KOG2550|consensus503 95.29
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 95.28
PRK14057254 epimerase; Provisional 95.23
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 95.07
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 95.07
PRK07315293 fructose-bisphosphate aldolase; Provisional 95.06
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 95.05
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 95.03
KOG1763|consensus343 94.92
PLN02363256 phosphoribosylanthranilate isomerase 94.87
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 94.86
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 94.85
smart0035627 ZnF_C3H1 zinc finger. 94.78
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 94.76
KOG2185|consensus486 94.72
PRK06801286 hypothetical protein; Provisional 94.72
PLN02424332 ketopantoate hydroxymethyltransferase 94.7
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 94.57
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 94.53
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 94.51
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 94.46
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 94.38
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 94.36
PRK07565 334 dihydroorotate dehydrogenase 2; Reviewed 94.36
PRK08091228 ribulose-phosphate 3-epimerase; Validated 94.31
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 94.22
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 94.21
PF00697197 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isome 94.19
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 94.18
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 94.18
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 94.1
PF00478 352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 94.06
PRK13523337 NADPH dehydrogenase NamA; Provisional 93.86
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 93.57
cd03324415 rTSbeta_L-fuconate_dehydratase Human rTS beta is e 93.53
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 93.53
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 93.4
KOG1677|consensus332 93.38
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 93.32
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 93.27
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 93.21
PRK08999312 hypothetical protein; Provisional 93.13
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 93.09
KOG1595|consensus528 93.08
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 92.97
PRK05437 352 isopentenyl pyrophosphate isomerase; Provisional 92.94
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 92.82
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 92.74
PRK05458 326 guanosine 5'-monophosphate oxidoreductase; Provisi 92.58
COG4948372 L-alanine-DL-glutamate epimerase and related enzym 92.31
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 92.29
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 92.25
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 92.16
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 92.15
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 92.13
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 92.08
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 92.05
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 91.99
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily o 91.95
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 91.94
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 91.9
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 91.81
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 91.72
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 91.68
TIGR02534368 mucon_cyclo muconate and chloromuconate cycloisome 91.65
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 91.62
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 91.45
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 90.98
COG0413268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 90.93
PRK14567253 triosephosphate isomerase; Provisional 90.9
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 90.87
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 90.72
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 90.54
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 90.53
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 90.5
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 90.48
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 90.43
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 90.39
PRK14017382 galactonate dehydratase; Provisional 90.31
KOG1040|consensus325 90.26
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 90.01
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 89.95
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 89.94
PRK08185283 hypothetical protein; Provisional 89.85
cd03326385 MR_like_1 Mandelate racemase (MR)-like subfamily o 89.82
PLN02979366 glycolate oxidase 89.81
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 89.79
cd03322361 rpsA The starvation sensing protein RpsA from E.co 89.79
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 89.75
cd03325352 D-galactonate_dehydratase D-galactonate dehydratas 89.73
PF00215226 OMPdecase: Orotidine 5'-phosphate decarboxylase / 89.73
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 89.68
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 89.61
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 89.51
cd03320263 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes 89.47
PRK05096 346 guanosine 5'-monophosphate oxidoreductase; Provisi 89.26
PRK15072404 bifunctional D-altronate/D-mannonate dehydratase; 89.23
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 89.15
PLN02535364 glycolate oxidase 89.09
TIGR01306 321 GMP_reduct_2 guanosine monophosphate reductase, ba 89.05
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate deca 88.98
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 88.88
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 88.84
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 88.84
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 88.78
PRK07709285 fructose-bisphosphate aldolase; Provisional 88.74
COG5252299 Uncharacterized conserved protein, contains CCCH-t 88.69
TIGR01305 343 GMP_reduct_1 guanosine monophosphate reductase, eu 88.59
COG5152259 Uncharacterized conserved protein, contains RING a 88.41
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 88.38
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 88.32
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 88.29
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 88.13
PF01680208 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p 88.1
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 88.04
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 88.02
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 88.0
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 87.82
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 87.66
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 87.51
PRK12656222 fructose-6-phosphate aldolase; Reviewed 87.31
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 87.28
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 87.06
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 87.04
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 87.03
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 86.97
PRK06852304 aldolase; Validated 86.9
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 86.8
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 86.54
KOG1492|consensus377 86.24
PRK08227264 autoinducer 2 aldolase; Validated 86.21
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 86.19
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 85.89
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 85.64
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 85.51
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 85.46
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 85.41
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 84.79
COG5152259 Uncharacterized conserved protein, contains RING a 84.73
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 84.65
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 84.62
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 84.47
PLN02274 505 inosine-5'-monophosphate dehydrogenase 84.35
PRK02901327 O-succinylbenzoate synthase; Provisional 84.31
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 84.29
PLN02424332 ketopantoate hydroxymethyltransferase 84.25
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 84.24
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 84.07
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 83.89
TIGR03247441 glucar-dehydr glucarate dehydratase. Glucarate deh 83.86
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 83.71
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 83.7
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 83.68
PRK02412253 aroD 3-dehydroquinate dehydratase; Provisional 83.68
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 83.6
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 83.26
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 83.06
COG4981 717 Enoyl reductase domain of yeast-type FAS1 [Lipid m 83.02
PRK13305218 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; 82.93
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 82.88
PRK05835307 fructose-bisphosphate aldolase; Provisional 82.77
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 82.71
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 82.65
TIGR01927307 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthe 82.6
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 82.44
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 82.43
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 82.41
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 82.34
PRK08610286 fructose-bisphosphate aldolase; Reviewed 82.3
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 82.23
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 82.17
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 82.05
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 81.93
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 81.92
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 81.71
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 81.69
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 81.55
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 81.07
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 81.01
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 80.91
TIGR01334277 modD putative molybdenum utilization protein ModD. 80.65
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 80.6
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 80.5
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 80.36
PRK01362214 putative translaldolase; Provisional 80.34
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 80.31
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 80.08
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 80.02
>KOG2333|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.6e-113  Score=895.45  Aligned_cols=489  Identities=44%  Similarity=0.774  Sum_probs=402.3

Q ss_pred             CCcccccccccceecccccchhccccccchhhhhhhcccccchhhhhhhhhhhhhcCCCCCCCCCCCCCCCcccCCcccc
Q psy9514           2 DASGVAKIKQEFIVEDHVKVLSIECVNETDKRKLEELEVEDDGTAKKKFKKNKQVLKGQNKARGPTFVTKPEDCYCPFLK   81 (611)
Q Consensus         2 ~~~g~a~ik~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gqnk~r~~~~~~~~~~~lC~~~~   81 (611)
                      .++||||||+||||+...+... ...+..+.++.++   + .+...||++.++.+++||||+|+. .+  +.++||++++
T Consensus        12 ~e~giapIK~eylvp~~~~~~~-~~~~~~~kR~~~~---~-~~~~~~Kr~~k~~~k~~~~k~r~~-~q--~~n~LCPsli   83 (614)
T KOG2333|consen   12 LERGIAPIKPEYLVPKENQKLA-AENQAKSKRKRRG---G-NGETEKKRKRKRERKEGQNKNRDV-AQ--VQNRLCPSLI   83 (614)
T ss_pred             hhcCCcccCHhhcCCCchhhhh-hcccccchhhhcc---C-ccchhhhhhhhhhhhhhccccchh-hh--hhhccChHhh
Confidence            3689999999999987643222 1122333333333   1 233344444467788999999998 43  4899999999


Q ss_pred             cCCCCCCCCCCCCCCCcCChhHHhhcCCCCCCCCCcceeccccCCCCCccccCccccCccCCCccchhhHhhhhccCCCc
Q psy9514          82 DSTLEQTCKYGEKCKFVHDKNVFMKSKPEDISEQCYVFLQHGYCPMGIACRFGSSHLDENGGNIVKEDVLKEWKNTVGNK  161 (611)
Q Consensus        82 ~~~~~~~C~~g~~C~f~Hd~~~yl~~k~~d~~~~C~~~~~~G~C~~G~~Crf~~~h~~~~~~~~~~~~~~~~~~~~~~~~  161 (611)
                      ++ +...|+|||+|||.|||+.||+.|++||++.||+|+++|+||||++|||+++|.+++|++++..+....  +..+..
T Consensus        84 ~g-~~~~C~f~d~Crf~HDi~ayLatK~~Dig~~Cp~f~s~G~Cp~G~~CRFl~aHld~~g~~~~~kek~~d--~~~~~~  160 (614)
T KOG2333|consen   84 QG-DISKCSFGDNCRFVHDIEAYLATKAPDIGPSCPVFESLGFCPYGFKCRFLGAHLDIEGNNLIQKEKDPD--GQFPPT  160 (614)
T ss_pred             cC-CCccCcccccccccccHHHHHhccCcccCCccceeeccccCCccceeehhhcccCccccchhhhhhCcc--cCCCCc
Confidence            98 435699999999999999999999999999999999999999999999999999999999875443321  222335


Q ss_pred             ccccCCHHHHHHHhcCcccCCchHHHHHHhhhcccCCCC--CcccccCCCccccccccccC----CCCCccc--cccccc
Q psy9514         162 TVNMLANEVRQDLRKHTYNFEKSEKICKENKASKNENKD--TDDCCKNQDSKVIEGREEIN----TPNTDDV--IKVQEE  233 (611)
Q Consensus       162 ~~n~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~----~~~~~~~--~~~~~~  233 (611)
                      +.|.+++++|.+|||++|+|+||++.|+.+++.....+.  ...-.+++. ++..+..+.+    ++.+...  ....-.
T Consensus       161 t~N~~s~elq~~LrKre~~fekse~~l~~~~~~~~~~~~~e~~~~e~ap~-ee~~~~~~~~~g~~~~~~~ee~t~~k~~~  239 (614)
T KOG2333|consen  161 TKNGVSKELQVDLRKREYDFEKSEEILEIIDSFEEARKMKEEEEVEKAPS-EENQEDQEQSVGPQTEQRLEELTEHKMKP  239 (614)
T ss_pred             cccccCHHHHHHHHHhhcChHHHHHHHHHHhcccccccCCccchhhcCcc-hhccccccccccccccccccccccccCcc
Confidence            679999999999999999999999999988765411000  000000000 0000000000    0000000  001112


Q ss_pred             cccCCCCccCCCCCCcccccCeeecCcEEeccCCCCCCHHHHHHHHHcCCCEEEecCcccchhhcCChhhhHhHhhccCC
Q psy9514         234 TKSGPVLDTDIIKIKNSEKKKIDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESE  313 (611)
Q Consensus       234 ~~~~~~~~~~~~~f~p~ei~~l~l~nrivlAPMt~~gnlpfRrl~~~~Ga~li~tEm~~~~~l~~g~~~e~~l~~~h~~e  313 (611)
                      +.++...+++.+++.|.+++.|+|++++|||||||+|||||||||+.+|||+||+||+++.||+||+.+||+|+++|.+|
T Consensus       240 ~sv~~~~de~si~l~p~eKk~lD~r~K~~LaPLTTvGNLPFRRlCk~lGADvTcgEMA~~tpLlqG~~sEWALlkRH~sE  319 (614)
T KOG2333|consen  240 TSVGLKYDEDSIRLRPQEKKLLDFRDKKYLAPLTTVGNLPFRRLCKKLGADVTCGEMAMATPLLQGTASEWALLKRHQSE  319 (614)
T ss_pred             ceecccccchhhccChhcccccccccceeeccccccCCccHHHHHHHhCCccchhHHHHHHHHhcccchhhhhhhhcCcc
Confidence            35677788888899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeEEEEecCCChhhHHHHHHHHhhhccceeeeccCCCCcchhhccCCCccccccccceeeecccCchHHHHHHHHHHHHh
Q psy9514         314 DLFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQ  393 (611)
Q Consensus       314 ~~~~vQi~g~~p~~~~~~a~~l~~~~~v~~idln~gcp~~~~~~~~~~~~l~~~~~~~ivQi~g~~p~~~~~aA~~l~~~  393 (611)
                      ..|||||+|+.|++++++|++|++...|||||||+||||++                                       
T Consensus       320 diFGVQlag~~pdt~~kaaq~i~e~~~VDFIDlN~GCPIDl---------------------------------------  360 (614)
T KOG2333|consen  320 DIFGVQLAGSKPDTAAKAAQVIAETCDVDFIDLNMGCPIDL---------------------------------------  360 (614)
T ss_pred             cceeeEeccCChHHHHHHHHHHHhhcceeeeeccCCCChhe---------------------------------------
Confidence            99999999999999999999999999999999999999888                                       


Q ss_pred             cccceEEeccCCCccceeccccccccccChHHHHHHHHHHHhhcC-CCEEEEEEccccCCchHHHHHHHHHH-HcCCCEE
Q psy9514         394 MVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMNEVSS-LPITVKTRTGIHKDNNIIHNFMPKFR-DWGASLI  471 (611)
Q Consensus       394 ~g~D~IELN~gCP~~~v~~~g~GsaLl~r~~~l~eIv~av~~~~~-~PvtVKiR~g~~~~~~~a~~la~~l~-~aGvd~I  471 (611)
                                      ++++|.||+|+++|..+.++|++|+++++ +|||||||+|..++.+.++.++..+. +||+++|
T Consensus       361 ----------------vy~qG~GsALl~rp~rl~~~l~~m~~vs~~iPiTVKiRTG~keg~~~a~~Li~~i~newg~sav  424 (614)
T KOG2333|consen  361 ----------------VYRQGGGSALLNRPARLIRILRAMNAVSGDIPITVKIRTGTKEGHPVAHELIPRIVNEWGASAV  424 (614)
T ss_pred             ----------------eeccCCcchhhcCcHHHHHHHHHHHHhccCCCeEEEEecccccCchhHHHHHHHHhhccCcceE
Confidence                            99999999999999999999999999996 69999999999999999999999998 9999999


Q ss_pred             EEEccccccccccCcChhHHHHHhhhcccCchhhhhcchhhHhcCCceEEeccccccccccCCccHHHHHHHHhhCCCCc
Q psy9514         472 TLHGRTREQRYTKQADWDYIEKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAP  551 (611)
Q Consensus       472 tvhgR~r~qr~~~~adw~~i~~~~~~~~~~~~~~~~~~~~l~~~G~~~itihgrtr~g~~~~~a~~~~i~~~~k~~~~iP  551 (611)
                      |+|||+|+||||+.|||+||.+|++..                                                ...+|
T Consensus       425 TlHGRSRqQRYTK~AnWdYi~e~a~~a------------------------------------------------k~~l~  456 (614)
T KOG2333|consen  425 TLHGRSRQQRYTKSANWDYIEECADKA------------------------------------------------KSALP  456 (614)
T ss_pred             EecCchhhhhhhcccChHHHHHHHHhc------------------------------------------------ccCce
Confidence            999999999999999999888886521                                                12389


Q ss_pred             EEEecCCCCHHHHHHHHHcCCCccEEEEcHHhhhCCchHHHHHcccCCCccccc
Q psy9514         552 LYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKEKKLFDIYAIV  605 (611)
Q Consensus       552 VIgnGgI~s~eda~~~l~~G~~aD~VmIGRgaL~dP~lf~ei~~g~~~dis~~e  605 (611)
                      |||||||+||+||++.+..+|.+|+||||||||++||||+||+++|+|||||+|
T Consensus       457 liGNGDi~S~eDw~~~~~~~p~v~svMIaRGALIKPWIFtEIkeqq~wD~sSte  510 (614)
T KOG2333|consen  457 LIGNGDILSWEDWYERLNQNPNVDSVMIARGALIKPWIFTEIKEQQHWDISSTE  510 (614)
T ss_pred             eEecCccccHHHHHHHhhcCCCcceEEeeccccccchHhhhhhhhhcCCccchH
Confidence            999999999999999999887899999999999999999999999999999998

>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>KOG2335|consensus Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>KOG2334|consensus Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>KOG0134|consensus Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>KOG2333|consensus Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>KOG1799|consensus Back     alignment and domain information
>KOG1677|consensus Back     alignment and domain information
>KOG1436|consensus Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>KOG2334|consensus Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>KOG2335|consensus Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1606|consensus Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>KOG0538|consensus Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>KOG1763|consensus Back     alignment and domain information
>PLN02363 phosphoribosylanthranilate isomerase Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>KOG2185|consensus Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PF00697 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isomerase; InterPro: IPR001240 Indole-3-glycerol phosphate synthase (IGPS) (see IPR001468 from INTERPRO) catalyzes the fourth step in the biosynthesis of tryptophan, the ring closure of 1-(2-carboxy-phenylamino)-1-deoxyribulose into indol-3-glycerol-phosphate Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>KOG1677|consensus Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>KOG1595|consensus Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>COG4948 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information
>KOG1040|consensus Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>cd03326 MR_like_1 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1 Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>PF00215 OMPdecase: Orotidine 5'-phosphate decarboxylase / HUMPS family; InterPro: IPR001754 Orotidine 5'-phosphate decarboxylase (OMPdecase) [, ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>cd03320 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK15072 bifunctional D-altronate/D-mannonate dehydratase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PF01680 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p is a highly conserved protein involved in growth arrest in Saccharomyces cerevisiae (Baker's yeast) [] Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK12656 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>KOG1492|consensus Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK02901 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>TIGR03247 glucar-dehydr glucarate dehydratase Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG4981 Enoyl reductase domain of yeast-type FAS1 [Lipid metabolism] Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01927 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query611
1vhn_A318 Crystal Structure Of A Putative Flavin Oxidoreducta 3e-13
3b0p_A350 Trna-Dihydrouridine Synthase From Thermus Thermophi 7e-07
3b0v_C363 Trna-Dihydrouridine Synthase From Thermus Thermophi 4e-05
1rgo_A70 Structural Basis For Recognition Of The Mrna Class 4e-04
>pdb|1VHN|A Chain A, Crystal Structure Of A Putative Flavin Oxidoreductase With Flavin Length = 318 Back     alignment and structure 
Iteration: 1

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 97/224 (43%), Gaps = 57/224 (25%)
Query: 372 GVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVIT 431
            VQ+ G+ P  L++  ++L E+    ++D+N GCP+  + K+G+G  LL+     + ++ 
Sbjct: 62  AVQIFGSEPNELSEAARILSEKY--KWIDLNAGCPVRKVVKEGAGGALLKDLRHFRYIVR 119
Query: 432 CMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYI 491
            + +  S   +VKTR G  K  N +        + G   + +H RT  Q +T +A+W   
Sbjct: 120 ELRKSVSGKFSVKTRLGWEK--NEVEEIYRILVEEGVDEVFIHTRTVVQSFTGRAEWK-- 175
Query: 492 EKCAQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAP 551
                                     +L  L  R                         P
Sbjct: 176 --------------------------ALSVLEKRI------------------------P 185
Query: 552 LYGNGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKE 595
            + +GDI + ED   +L++S    G+++ RGA+ +PWIF++IK+
Sbjct: 186 TFVSGDIFTPEDAKRALEES-GCDGLLVARGAIGRPWIFKQIKD 228
>pdb|3B0P|A Chain A, Trna-Dihydrouridine Synthase From Thermus Thermophilus Length = 350 Back     alignment and structure
>pdb|3B0V|C Chain C, Trna-Dihydrouridine Synthase From Thermus Thermophilus In Complex With Trna Length = 363 Back     alignment and structure
>pdb|1RGO|A Chain A, Structural Basis For Recognition Of The Mrna Class Ii Au- Rich Element By The Tandem Zinc Finger Domain Of Tis11d Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query611
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 2e-49
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 8e-09
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 5e-05
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Length = 318 Back     alignment and structure
 Score =  173 bits (441), Expect = 2e-49
 Identities = 71/341 (20%), Positives = 125/341 (36%), Gaps = 113/341 (33%)

Query: 255 IDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESED 314
           +  + K+ L+P+    +  FR L  +WGAD   SEM  A   L +S +   L+     E 
Sbjct: 1   MSLEVKVGLAPMAGYTDSAFRTLAFEWGADFAFSEMVSAKGFLMNSQKTEELLP-QPHER 59

Query: 315 LFGVQLCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQ 374
              VQ+ G+ P  L++  ++L E+    ++D+N GCP+  + K+G+G  LL+    F   
Sbjct: 60  NVAVQIFGSEPNELSEAARILSEK--YKWIDLNAGCPVRKVVKEGAGGALLKDLRHF--- 114

Query: 375 LCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGLLQRANILQSVITCMN 434
                                                             I++ +     
Sbjct: 115 ------------------------------------------------RYIVRELR---- 122

Query: 435 EVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKC 494
           +  S   +VKTR G  K+   +        + G   + +H RT  Q +T +A+W  +   
Sbjct: 123 KSVSGKFSVKTRLGWEKNE--VEEIYRILVEEGVDEVFIHTRTVVQSFTGRAEWKALSVL 180

Query: 495 AQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYG 554
            +       I                                              P + 
Sbjct: 181 EK------RI----------------------------------------------PTFV 188

Query: 555 NGDILSYEDYTESLKKSPSISGVMIGRGALIKPWIFQEIKE 595
           +GDI + ED   +L++S    G+++ RGA+ +PWIF++IK+
Sbjct: 189 SGDIFTPEDAKRALEES-GCDGLLVARGAIGRPWIFKQIKD 228
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Length = 350 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query611
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 100.0
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 100.0
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 100.0
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 100.0
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 100.0
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 100.0
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 100.0
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 100.0
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 100.0
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 100.0
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 100.0
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 100.0
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 100.0
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 100.0
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 100.0
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 100.0
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 100.0
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 100.0
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 100.0
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 100.0
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 99.97
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 99.96
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 99.95
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 99.95
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 99.95
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 99.95
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 99.94
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 99.94
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 99.93
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 99.92
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 99.91
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.9
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 99.83
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 99.82
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 99.8
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 99.75
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 99.74
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.72
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 99.71
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 99.66
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 99.6
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 99.55
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 99.51
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 99.5
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 99.48
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.41
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 99.41
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 99.4
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 99.4
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 99.38
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 99.37
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 99.37
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 99.35
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.34
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 99.34
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 99.28
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 99.24
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 99.23
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 99.21
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 99.19
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 99.17
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 99.15
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 99.11
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 99.11
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 99.08
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 99.08
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 99.08
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.06
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 99.04
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 99.02
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 99.0
3tdn_A 247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.96
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.95
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 98.93
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.88
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 98.87
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 98.84
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.8
1qo2_A 241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 98.74
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 98.74
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 98.72
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 98.71
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 98.7
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 98.64
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 98.63
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 98.59
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 98.57
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.56
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 98.52
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 98.5
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.49
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 98.49
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 98.49
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 98.48
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.48
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 98.41
1thf_D 253 HISF protein; thermophIle, TIM-barrel, histidine b 98.4
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 98.39
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.36
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 98.35
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 98.35
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 98.34
1ka9_F 252 Imidazole glycerol phosphtate synthase; riken stru 98.33
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 98.32
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 98.32
2gl5_A410 Putative dehydratase protein; structural genomics, 98.31
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 98.28
3eez_A378 Putative mandelate racemase/muconate lactonizing e 98.27
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 98.26
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 98.26
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 98.23
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 98.22
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 98.21
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 98.18
1h5y_A 253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.18
2poz_A392 Putative dehydratase; octamer, structural genomics 98.18
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 98.17
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 98.15
2y88_A 244 Phosphoribosyl isomerase A; aromatic amino acid bi 98.14
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 98.14
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 98.13
2qgy_A391 Enolase from the environmental genome shotgun sequ 98.13
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 98.12
1vzw_A 244 Phosphoribosyl isomerase A; histidine biosynthesis 98.11
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 98.09
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 98.09
3rcy_A 433 Mandelate racemase/muconate lactonizing enzyme-LI 98.08
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 98.07
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 98.06
2rhk_C72 Cleavage and polyadenylation specificity factor su 98.06
1ujp_A271 Tryptophan synthase alpha chain; riken structural 98.05
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 98.04
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 98.04
2o56_A407 Putative mandelate racemase; dehydratase, structur 98.03
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 98.02
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.02
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 98.01
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 98.01
2oz8_A389 MLL7089 protein; structural genomics, unknown func 98.0
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 98.0
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 97.96
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 97.96
1viz_A240 PCRB protein homolog; structural genomics, unknown 97.94
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 97.91
2w6r_A 266 Imidazole glycerol phosphate synthase subunit HISF 97.9
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 97.89
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 97.88
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 97.88
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.88
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 97.86
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 97.84
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 97.83
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 97.82
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 97.8
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 97.79
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 97.77
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 97.77
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 97.75
3rr1_A 405 GALD, putative D-galactonate dehydratase; enolase, 97.74
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 97.74
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 97.72
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 97.72
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 97.72
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 97.71
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 97.71
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 97.71
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 97.7
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 97.68
1tzz_A392 Hypothetical protein L1841; structural genomics, m 97.67
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 97.64
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 97.61
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.57
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 97.54
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 97.51
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 97.51
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.51
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 97.5
3oa3_A288 Aldolase; structural genomics, seattle structural 97.5
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 97.49
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 97.48
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 97.47
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 97.47
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 97.44
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 97.42
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 97.39
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 97.39
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 97.38
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 97.37
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 97.36
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 97.32
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 97.31
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 97.31
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 97.31
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 97.3
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 97.29
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 97.29
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 97.29
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 97.29
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 97.27
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 97.25
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 97.24
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 97.24
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 97.2
4gj1_A 243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.2
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 97.18
3tha_A252 Tryptophan synthase alpha chain; structural genomi 97.17
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 97.16
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 97.16
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 97.12
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 97.09
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 97.07
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 97.06
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 97.05
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 97.04
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 97.03
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 97.03
3r0u_A379 Enzyme of enolase superfamily; structural genomics 97.03
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 96.98
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 96.98
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 96.98
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 96.97
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 96.93
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 96.91
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.87
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 96.86
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 96.86
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 96.85
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 96.8
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 96.78
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 96.77
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 96.71
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 96.71
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 96.7
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 96.61
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 96.6
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 96.59
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 96.56
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 96.55
2qr6_A 393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 96.53
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 96.52
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 96.5
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 96.47
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 96.46
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 96.43
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 96.36
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 96.35
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 96.26
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 96.23
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 96.18
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 96.15
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 96.15
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 96.09
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 96.08
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 96.04
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 96.02
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 95.93
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 95.88
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 95.87
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 95.86
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 95.83
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 95.8
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 95.78
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 95.61
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 95.47
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 95.46
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 95.4
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 95.3
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 95.26
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 95.24
1ypf_A 336 GMP reductase; GUAC, purines, pyrimidines, nucleos 95.23
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 95.22
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 95.21
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 95.19
2agk_A 260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 95.19
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 95.16
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 95.14
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 95.06
3kts_A192 Glycerol uptake operon antiterminator regulatory; 95.05
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 95.0
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 94.93
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 94.92
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 94.88
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 94.84
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 94.82
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 94.72
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 94.67
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 94.65
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 94.6
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 94.56
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 94.52
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 94.29
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 94.28
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 94.23
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 94.22
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 94.15
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 94.06
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 94.05
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 94.0
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 93.94
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 93.94
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 93.9
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 93.86
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 93.82
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 93.82
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 93.49
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 93.47
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 93.21
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 93.11
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 93.08
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 93.06
3va8_A445 Probable dehydratase; enolase, magnesium binding s 93.03
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 92.97
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 92.92
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 92.84
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 92.81
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 92.7
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 92.52
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 92.51
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 92.39
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 92.31
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 92.3
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 92.2
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 92.05
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 92.03
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 91.92
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 91.89
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 91.84
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 91.83
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 91.82
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 91.81
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 91.72
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 91.56
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 91.42
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 91.39
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 91.38
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 91.37
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 91.27
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 90.89
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 90.86
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 90.69
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 90.67
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 90.65
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 90.63
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 90.51
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 90.19
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 90.17
1p0k_A 349 Isopentenyl-diphosphate delta-isomerase; terpene b 90.12
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 90.07
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 90.03
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 89.97
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 89.92
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 89.85
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 89.74
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 89.73
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 89.73
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 89.42
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 89.27
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 89.26
2opj_A327 O-succinylbenzoate-COA synthase; TIM barrel, struc 89.11
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 88.4
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 88.37
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 88.34
4h2h_A376 Mandelate racemase/muconate lactonizing enzyme; en 88.23
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 87.98
1eep_A 404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 87.84
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 87.8
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 87.77
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 87.54
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 87.51
2c6q_A 351 GMP reductase 2; TIM barrel, metal-binding, NADP, 87.02
3vnd_A 267 TSA, tryptophan synthase alpha chain; psychrophili 86.98
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 86.97
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 86.8
3b0p_A 350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 86.8
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 86.73
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 86.66
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 86.46
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 86.33
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 86.31
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 86.13
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 85.97
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 85.81
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 85.81
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 85.65
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 85.11
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 85.04
3cyj_A372 Mandelate racemase/muconate lactonizing enzyme-LI 84.75
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 84.56
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 84.46
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 84.3
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 84.25
2ffc_A353 Orotidine 5-monophosphate decarboxylase; PV-PF10_0 84.24
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 83.72
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 83.6
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 83.59
4adt_A 297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 83.57
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 83.41
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 83.39
3mzn_A 450 Glucarate dehydratase; lyase, structural genomics, 83.24
3qw3_A255 Orotidine-5-phosphate decarboxylase/orotate phosph 83.16
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 83.15
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 82.97
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 82.87
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 82.77
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 82.76
3p0w_A 470 Mandelate racemase/muconate lactonizing protein; s 82.65
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 81.97
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 81.78
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 81.77
2ekc_A 262 AQ_1548, tryptophan synthase alpha chain; structur 81.77
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 81.66
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM 81.14
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 81.08
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 81.05
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 81.04
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 81.01
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 80.79
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 80.76
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 80.58
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 80.49
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 80.48
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 80.45
3fxg_A 455 Rhamnonate dehydratase; structural gemomics, enola 80.29
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 80.23
1qop_A 268 Tryptophan synthase alpha chain; lyase, carbon-oxy 80.2
3dz1_A 313 Dihydrodipicolinate synthase; lysine biosynthesis, 80.16
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; de 80.08
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
Probab=100.00  E-value=1.1e-41  Score=357.66  Aligned_cols=228  Identities=30%  Similarity=0.557  Sum_probs=191.1

Q ss_pred             eeecCcEEeccCCCCCCHHHHHHHHHcCCCEEEecCcccchhhcCChhhhHhHhhccCCCeEEEEecCCChhhHHHHHHH
Q psy9514         255 IDWQGKLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQL  334 (611)
Q Consensus       255 l~l~nrivlAPMt~~gnlpfRrl~~~~Ga~li~tEm~~~~~l~~g~~~e~~l~~~h~~e~~~~vQi~g~~p~~~~~~a~~  334 (611)
                      ++|+||++||||+++++++||++++++|++++||||+.+.++..+.+..|..+ .|..+.++++||+|++          
T Consensus         1 ~~l~nri~~APM~~~t~~~~r~~~~~~G~gli~te~~~~~~~~~~~~~~~~~l-~~~~~~~~~~QL~g~~----------   69 (318)
T 1vhn_A            1 MSLEVKVGLAPMAGYTDSAFRTLAFEWGADFAFSEMVSAKGFLMNSQKTEELL-PQPHERNVAVQIFGSE----------   69 (318)
T ss_dssp             ----CEEEECCCTTTCSHHHHHHHHTTTCCCEECSCEEHHHHHTTCHHHHHHS-CCTTCTTEEEEEECSC----------
T ss_pred             CccCCCEEECCCCCCCcHHHHHHHHHHCcCEEEeCCEEEcccccCCHhHHHhh-hCcCCCeEEEEeCCCC----------
Confidence            46899999999999999999999999999999999999998887777777777 6666666666665544          


Q ss_pred             HhhhccceeeeccCCCCcchhhccCCCccccccccceeeecccCchHHHHHHHHHHHHhcccceEEeccCCCccceeccc
Q psy9514         335 LEEQMAVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQG  414 (611)
Q Consensus       335 l~~~~~v~~idln~gcp~~~~~~~~~~~~l~~~~~~~ivQi~g~~p~~~~~aA~~l~~~~g~D~IELN~gCP~~~v~~~g  414 (611)
                                                                   |+.+.++|+++.+ + ||+||||+|||..++++++
T Consensus        70 ---------------------------------------------~~~~~~aa~~a~~-~-~d~Iein~gcP~~~~r~~~  102 (318)
T 1vhn_A           70 ---------------------------------------------PNELSEAARILSE-K-YKWIDLNAGCPVRKVVKEG  102 (318)
T ss_dssp             ---------------------------------------------HHHHHHHHHHHTT-T-CSEEEEEECCCCHHHHHTT
T ss_pred             ---------------------------------------------HHHHHHHHHHHHH-h-CCEEEEECCCCcHhcCCCC
Confidence                                                         4455566666654 4 9999999999999999999


Q ss_pred             cccccccChHHHHHHHHHHHhhcCCCEEEEEEccccCCchHHHHHHHHHHHcCCCEEEEEccccccccccCcChhHHHHH
Q psy9514         415 SGSGLLQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKC  494 (611)
Q Consensus       415 ~GsaLl~r~~~l~eIv~av~~~~~~PvtVKiR~g~~~~~~~a~~la~~l~~aGvd~ItvhgR~r~qr~~~~adw~~i~~~  494 (611)
                      ||++|++|++++.+++++|++++++||+||+|.|+....  ..++++.++++|+++|+||+|++.+.|            
T Consensus       103 ~G~~l~~~~~~~~eiv~~v~~~~~~pv~vKir~G~~~~~--~~~~a~~l~~~G~d~i~v~g~~~~~~~------------  168 (318)
T 1vhn_A          103 AGGALLKDLRHFRYIVRELRKSVSGKFSVKTRLGWEKNE--VEEIYRILVEEGVDEVFIHTRTVVQSF------------  168 (318)
T ss_dssp             CGGGGGSCHHHHHHHHHHHHHHCSSEEEEEEESCSSSCC--HHHHHHHHHHTTCCEEEEESSCTTTTT------------
T ss_pred             cccchhhCHHHHHHHHHHHHHhhCCCEEEEecCCCChHH--HHHHHHHHHHhCCCEEEEcCCCccccC------------
Confidence            999999999999999999999999999999999986643  348999999999999999999876663            


Q ss_pred             hhhcccCchhhhhcchhhHhcCCceEEeccccccccccCCccHHHHHHHHhhCCCCcEEEecCCCCHHHHHHHHHcCCCc
Q psy9514         495 AQLCSRDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSI  574 (611)
Q Consensus       495 ~~~~~~~~~~~~~~~~~l~~~G~~~itihgrtr~g~~~~~a~~~~i~~~~k~~~~iPVIgnGgI~s~eda~~~l~~G~~a  574 (611)
                                                           .++++|+++.++.+   ++|||+||||.|++|+.++++.+ +|
T Consensus       169 -------------------------------------~~~~~~~~i~~i~~---~ipVi~~GgI~s~~da~~~l~~~-ga  207 (318)
T 1vhn_A          169 -------------------------------------TGRAEWKALSVLEK---RIPTFVSGDIFTPEDAKRALEES-GC  207 (318)
T ss_dssp             -------------------------------------SSCCCGGGGGGSCC---SSCEEEESSCCSHHHHHHHHHHH-CC
T ss_pred             -------------------------------------CCCcCHHHHHHHHc---CCeEEEECCcCCHHHHHHHHHcC-CC
Confidence                                                 33444544444433   79999999999999999999954 49


Q ss_pred             cEEEEcHHhhhCCchHHHHHc
Q psy9514         575 SGVMIGRGALIKPWIFQEIKE  595 (611)
Q Consensus       575 D~VmIGRgaL~dP~lf~ei~~  595 (611)
                      |+|||||++|.|||+|.++++
T Consensus       208 d~V~iGR~~l~~P~l~~~~~~  228 (318)
T 1vhn_A          208 DGLLVARGAIGRPWIFKQIKD  228 (318)
T ss_dssp             SEEEESGGGTTCTTHHHHHHH
T ss_pred             CEEEECHHHHhCcchHHHHHH
Confidence            999999999999999999988
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>2opj_A O-succinylbenzoate-COA synthase; TIM barrel, structural genomics, protein structure initiative; 1.60A {Thermobifida fusca} PDB: 2qvh_A* Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>4h2h_A Mandelate racemase/muconate lactonizing enzyme; enolase, mandelate racemase subgroup, enzyme function initia EFI, structural genomics; HET: 0XW; 1.70A {Pelagibaca bermudensis} PDB: 2pmq_A* Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>3cyj_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, isomerase, PSI-2; 2.30A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2ffc_A Orotidine 5-monophosphate decarboxylase; PV-PF10_0225, SGC, structural genomics, struc genomics consortium, lyase; HET: U5P; 1.70A {Plasmodium vivax} SCOP: c.1.2.3 PDB: 2guu_A* Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Back     alignment and structure
>3qw3_A Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative (OMPDCASE-OPRTASE,...; orotidine monophosphate decarboxylase; 1.70A {Leishmania infantum} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 4hn8_A 3nxl_A Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3fxg_A Rhamnonate dehydratase; structural gemomics, enolase superfamily, NYSGXRC, target 9265J, lyase, structural genomics, PSI-2; 1.90A {Gibberella zeae ph-1} PDB: 2p0i_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 611
d1vhna_305 c.1.4.1 (A:) Putative flavin oxidoreducatase TM009 9e-16
d1vhna_305 c.1.4.1 (A:) Putative flavin oxidoreducatase TM009 2e-05
d1vhna_305 c.1.4.1 (A:) Putative flavin oxidoreducatase TM009 1e-04
d1ep3a_311 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactoco 6e-08
d1gtea2312 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenas 3e-05
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Putative flavin oxidoreducatase TM0096
species: Thermotoga maritima [TaxId: 2336]

 Score = 76.2 bits (186), Expect = 9e-16
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 3/103 (2%)

Query: 260 KLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQ 319
           K+ L+P+    +  FR L  +WGAD   SEM  A   L +S +   L+     E    VQ
Sbjct: 2   KVGLAPMAGYTDSAFRTLAFEWGADFAFSEMVSAKGFLMNSQKTEELL-PQPHERNVAVQ 60

Query: 320 LCGNNPYVLTKCTQLLEEQMAVDFVDVNLGCPIEFIYKQGSGS 362
           + G+ P  L++  ++L       ++D+N GCP+  + K+G+G 
Sbjct: 61  IFGSEPNELSEAARIL--SEKYKWIDLNAGCPVRKVVKEGAGG 101
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Length = 305 Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Length = 305 Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 311 Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Length = 312 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query611
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 100.0
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 100.0
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 100.0
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 100.0
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 99.97
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 99.96
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 99.96
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 99.96
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 99.95
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.91
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 99.88
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.73
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 99.69
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 99.62
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 99.59
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 99.59
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 98.98
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.97
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 98.78
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.72
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 98.4
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 98.39
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 98.31
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 98.24
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 98.22
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 98.2
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 98.15
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 98.07
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 98.05
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 98.03
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 98.0
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 98.0
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 97.98
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 97.83
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.82
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 97.71
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 97.7
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 97.58
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.53
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 97.52
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 97.49
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 97.48
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 97.47
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 97.45
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 97.4
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 97.38
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 97.36
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 97.33
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 97.22
d1ofda2809 Alpha subunit of glutamate synthase, central and F 97.18
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.16
d1thfd_ 253 Cyclase subunit (or domain) of imidazoleglycerolph 97.13
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 97.12
d1h5ya_ 252 Cyclase subunit (or domain) of imidazoleglycerolph 97.06
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 97.02
d1ka9f_ 251 Cyclase subunit (or domain) of imidazoleglycerolph 96.97
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 96.97
d1jvna1 323 Cyclase subunit (or domain) of imidazoleglycerolph 96.93
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 96.89
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 96.85
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 96.82
d1vzwa1 239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.8
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 96.79
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 96.71
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 96.7
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 96.64
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 96.62
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 96.56
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 96.49
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 96.41
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 96.36
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 96.34
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 96.32
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 96.28
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 96.27
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 96.24
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 96.23
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 96.08
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 96.01
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 95.91
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 95.81
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 95.8
d1qo2a_ 241 Phosphoribosylformimino-5-aminoimidazole carboxami 95.79
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 95.79
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 95.74
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 95.57
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 95.28
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 95.13
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 94.99
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 94.89
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 94.78
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 94.23
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 94.1
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 94.08
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 94.05
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 93.96
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 93.91
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 93.85
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 93.83
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 93.82
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 93.82
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 93.79
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 93.68
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 93.62
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 93.61
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 93.07
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 93.01
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 92.7
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 92.39
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 92.3
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 92.22
d1eepa_ 388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 91.94
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 91.64
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 91.48
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 91.26
d2g50a2282 Pyruvate kinase, N-terminal domain {Rabbit (Orycto 91.25
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 91.23
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 91.07
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 91.05
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 90.69
d1vrda1 330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 90.52
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 90.45
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 90.42
d1wx0a1211 Decameric fructose-6-phosphate aldolase/transaldol 90.3
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 90.1
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 89.97
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 89.73
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 89.28
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 89.2
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 88.4
d1l6wa_220 Decameric fructose-6-phosphate aldolase/transaldol 87.64
d1jdfa1 309 D-glucarate dehydratase {Escherichia coli [TaxId: 87.56
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 87.48
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 87.11
d1vpxa_218 Decameric fructose-6-phosphate aldolase/transaldol 86.12
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 85.81
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 83.94
d1vqta1198 Orotidine 5'-monophosphate decarboxylase (OMP deca 83.21
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 83.08
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 82.91
d1jpdx1208 L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 82.57
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 82.19
d2ffca1332 Orotidine 5'-monophosphate decarboxylase (OMP deca 81.73
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 81.67
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 80.95
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 80.81
d3bofa1260 Cobalamin-dependent methionine synthase MetH, C-te 80.49
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 80.16
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Putative flavin oxidoreducatase TM0096
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=1.6e-49  Score=412.45  Aligned_cols=223  Identities=30%  Similarity=0.552  Sum_probs=187.0

Q ss_pred             cEEeccCCCCCCHHHHHHHHHcCCCEEEecCcccchhhcCChhhhHhHhhccCCCeEEEEecCCChhhHHHHHHHHhhhc
Q psy9514         260 KLYLSPLTTVGNLPFRRLCKKWGADITCSEMAVATELLKSSPQEWALIKRHESEDLFGVQLCGNNPYVLTKCTQLLEEQM  339 (611)
Q Consensus       260 rivlAPMt~~gnlpfRrl~~~~Ga~li~tEm~~~~~l~~g~~~e~~l~~~h~~e~~~~vQi~g~~p~~~~~~a~~l~~~~  339 (611)
                      |++||||+++|++|||+||+++|++++||||+.+..++++.+..+.+. .++.|.|+++||+|++|+             
T Consensus         2 ki~LAPM~g~td~~fR~l~~~~g~~~~~Temi~~~~~~~~~~~~~~~~-~~~~e~p~~~Ql~g~~p~-------------   67 (305)
T d1vhna_           2 KVGLAPMAGYTDSAFRTLAFEWGADFAFSEMVSAKGFLMNSQKTEELL-PQPHERNVAVQIFGSEPN-------------   67 (305)
T ss_dssp             EEEECCCTTTCSHHHHHHHHTTTCCCEECSCEEHHHHHTTCHHHHHHS-CCTTCTTEEEEEECSCHH-------------
T ss_pred             eEEEECcCCCccHHHHHHHHHHCcCEEEECCEEechhhhCChhhHhhc-cCCCCCCeEEEEeccchh-------------
Confidence            689999999999999999999999999999999998887766554433 345455555555555554             


Q ss_pred             cceeeeccCCCCcchhhccCCCccccccccceeeecccCchHHHHHHHHHHHHhcccceEEeccCCCccceecccccccc
Q psy9514         340 AVDFVDVNLGCPIEFIYKQGSGSGLLQRANLFGVQLCGNNPYVLTKCTQLLEEQMVVDFVDVNLGCPIEFIYKQGSGSGL  419 (611)
Q Consensus       340 ~v~~idln~gcp~~~~~~~~~~~~l~~~~~~~ivQi~g~~p~~~~~aA~~l~~~~g~D~IELN~gCP~~~v~~~g~GsaL  419 (611)
                                                                .+.+||+.+.  .|+|+||||||||+..+.+.|+|++|
T Consensus        68 ------------------------------------------~~~~aa~~~~--~~~~~IdlN~GCP~~~v~~~g~Ga~L  103 (305)
T d1vhna_          68 ------------------------------------------ELSEAARILS--EKYKWIDLNAGCPVRKVVKEGAGGAL  103 (305)
T ss_dssp             ------------------------------------------HHHHHHHHHT--TTCSEEEEEECCCCHHHHHTTCGGGG
T ss_pred             ------------------------------------------hhhhhhhhhh--hheeeeeEEEEecchhhcccccceee
Confidence                                                      4444554443  28899999999999999999999999


Q ss_pred             ccChHHHHHHHHHHHhhcCCCEEEEEEccccCCchHHHHHHHHHHHcCCCEEEEEccccccccccCcChhHHHHHhhhcc
Q psy9514         420 LQRANILQSVITCMNEVSSLPITVKTRTGIHKDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCS  499 (611)
Q Consensus       420 l~r~~~l~eIv~av~~~~~~PvtVKiR~g~~~~~~~a~~la~~l~~aGvd~ItvhgR~r~qr~~~~adw~~i~~~~~~~~  499 (611)
                      |.+|+++.+||+++++.+++|||||+|+|+++.  ...++++.++++|+++|+||||++.|+|+.+++|++|        
T Consensus       104 l~~p~~~~~iv~~~~~~~~~pvsvK~RlG~d~~--~~~~~~~~l~~~G~~~itvH~Rt~~q~~~~~a~~~~i--------  173 (305)
T d1vhna_         104 LKDLRHFRYIVRELRKSVSGKFSVKTRLGWEKN--EVEEIYRILVEEGVDEVFIHTRTVVQSFTGRAEWKAL--------  173 (305)
T ss_dssp             GSCHHHHHHHHHHHHHHCSSEEEEEEESCSSSC--CHHHHHHHHHHTTCCEEEEESSCTTTTTSSCCCGGGG--------
T ss_pred             ccCHHHHHHHhhhhhhhcccccccccccCcccc--hhhHHHHHHHHhCCcEEEechhhhhhccccchhhhHH--------
Confidence            999999999999999999999999999998654  4568999999999999999999999997666666543        


Q ss_pred             cCchhhhhcchhhHhcCCceEEeccccccccccCCccHHHHHHHHhhCCCCcEEEecCCCCHHHHHHHHHcCCCccEEEE
Q psy9514         500 RDNNIIHNFMPKFRDWGASLITLHGRTREQRYTKQADWDYIEKCAQLCSPAPLYGNGDILSYEDYTESLKKSPSISGVMI  579 (611)
Q Consensus       500 ~~~~~~~~~~~~l~~~G~~~itihgrtr~g~~~~~a~~~~i~~~~k~~~~iPVIgnGgI~s~eda~~~l~~G~~aD~VmI  579 (611)
                                                               +++.   .++|||+||||.|++|+.++++.+ +||||||
T Consensus       174 -----------------------------------------~~~~---~~ipvi~NGdI~s~~d~~~~l~~t-g~dgVMi  208 (305)
T d1vhna_         174 -----------------------------------------SVLE---KRIPTFVSGDIFTPEDAKRALEES-GCDGLLV  208 (305)
T ss_dssp             -----------------------------------------GGSC---CSSCEEEESSCCSHHHHHHHHHHH-CCSEEEE
T ss_pred             -----------------------------------------Hhhh---hhhhhhcccccccHHHHHHHHHhc-CCCeEeh
Confidence                                                     3221   268999999999999999999865 5999999


Q ss_pred             cHHhhhCCchHHHHHc
Q psy9514         580 GRGALIKPWIFQEIKE  595 (611)
Q Consensus       580 GRgaL~dP~lf~ei~~  595 (611)
                      |||+|.|||+|.+|++
T Consensus       209 GRgal~nP~if~~i~~  224 (305)
T d1vhna_         209 ARGAIGRPWIFKQIKD  224 (305)
T ss_dssp             SGGGTTCTTHHHHHHH
T ss_pred             hHHHHHhhhHhhhhhh
Confidence            9999999999999864
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wx0a1 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ffca1 c.1.2.3 (A:20-351) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure