Diaphorina citri psyllid: psy9518


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MIGRGALIKPWIFQEIKEKKLFDISSAERFDILKEYVNYGLEHWGSDTRGVETTRRFLLEWLSFLHRYIPVGLLESTQKMNQRPPMYHGRNELETLMTSSNCSDWIKISEMLLGKIPAGFSFLPKHKANSWK
cccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHccccccccEEcccccccccc
MIGRGALIKPWIFQEIKEKKLFDISSAERFDILKEYVNYGLEHWGSDTRGVETTRRFLLEWLSFLHRYIPVGLLESTQKMNQRPPMYHGRNELETLMTSSNCSDWIKISEMLLGKIPAGFSFLPKHK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGRGALIKPWIFQEIKEKKLFDISSAERFDILKEYVNYGLEHWGSDTRGVETTRRFLLEWLSFLHRYIPVGLLESTQKMNQRPPMYHGRNELETLMTSSNCSDWIKISEMLLGKIPAGFSFLPKHKANSWK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.confidentQ28BT8
tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs. Specifically modifies U47 in cytoplasmic tRNAs.confidentA2QAU6
tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs. Specifically modifies U47 in cytoplasmic tRNAs.confidentP0CN28

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VHN, chain A
Confidence level:confident
Coverage over the Query: 1-100
View the alignment between query and template
View the model in PyMOL