Diaphorina citri psyllid: psy9523


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MEKLEFYSWDSGGYDQITLSFHLTSIYDHSIFEAFSKVIQKLIPQLPTLENLLNILINNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMVDLVIDVSGIYGK
cccccHHHHcccccccCEEEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEEccEEEEEccccccccHHHHHHHHHHHHHHHHHHHccc
****EFYSWDSGGYDQITLSFHLTSIYDHSIFEAFSKVIQKLIPQLPTLENLLNILINNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMVDLVIDVSGIYGK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKLEFYSWDSGGYDQITLSFHLTSIYDHSIFEAFSKVIQKLIPQLPTLENLLNILINNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMVDLVIDVSGIYGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related GTP-binding protein C Has guanine nucleotide-binding activity but weak intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids.confidentQ99K70
GTP-binding protein gtr2 GTPase. Component of the GSE complex, a GTPase complex required for intracellular sorting of GAP1 out of the endosome.confidentO74544
Ras-related GTP-binding protein C Has guanine nucleotide-binding activity but weak intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids.confidentQ9HB90

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0019003 [MF]GDP bindingprobableGO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031902 [CC]late endosome membraneprobableGO:0005737, GO:0005575, GO:0005770, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032008 [BP]positive regulation of TOR signaling cascadeprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0008150, GO:0023051, GO:0048518, GO:0032006, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0000329 [CC]fungal-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000324, GO:0000323, GO:0000322, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0043231, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0071230 [BP]cellular response to amino acid stimulusprobableGO:1901700, GO:0043200, GO:0051716, GO:0009719, GO:1901701, GO:1901698, GO:0071417, GO:1901699, GO:0008150, GO:0044699, GO:0071229, GO:0071495, GO:0071310, GO:0044763, GO:0001101, GO:0070887, GO:0050896, GO:0042221, GO:0009987, GO:0010243, GO:0010033
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0051179 [BP]localizationprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R7W, chain B
Confidence level:very confident
Coverage over the Query: 9-107
View the alignment between query and template
View the model in PyMOL