Has guanine nucleotide-binding activity but weak intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. Homo sapiens (taxid: 9606)
>sp|Q99K70|RRAGC_MOUSE Ras-related GTP-binding protein C OS=Mus musculus GN=Rragc PE=2 SV=1
Has guanine nucleotide-binding activity but weak intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids.
Mus musculus (taxid: 10090)
>sp|Q9NQL2|RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens GN=RRAGD PE=1 SV=1
Has guanine nucleotide-binding activity but lacks intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids.
Homo sapiens (taxid: 9606)
>sp|Q7TT45|RRAGD_MOUSE Ras-related GTP-binding protein D OS=Mus musculus GN=Rragd PE=2 SV=2
Has guanine nucleotide-binding activity but lacks intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids.
GTPase. Component of the GSE complex, a GTPase complex required for intracellular sorting of GAP1 out of the endosome. Component of the EGO complex, a complex involved in the regulation of microautophagy.
GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B. Length = 230
>gnl|CDD|206745 cd11385, RagC_like, Rag GTPase, subfamily of Ras-related GTPases, includes Ras-related GTP-binding proteins C and D
RagC and RagD are closely related Rag GTPases (ras-related GTP-binding protein C and D) that constitute a unique subgroup of the Ras superfamily, and are functional homologs of Saccharomyces cerevisiae Gtr2. These domains form heterodimers with RagA or RagB, and similarly, Gtr2 dimerizes with Gtr1 in order to function. They play an essential role in regulating amino acid-induced target of rapamycin complex 1 (TORC1) kinase signaling, exocytic cargo sorting at endosomes, and epigenetic control of gene expression. In response to amino acids, the Rag GTPases guide the TORC1 complex to activate the platform containing Rheb proto-oncogene by driving the relocalization of mTORC1 from discrete locations in the cytoplasm to a late endosomal and/or lysosomal compartment that is Rheb-enriched and contains Rab-7. Length = 175
>gnl|CDD|206742 cd09915, Rag, Rag GTPase subfamily of Ras-related GTPases
Rag GTPases (ras-related GTP-binding proteins) constitute a unique subgroup of the Ras superfamily, playing an essential role in regulating amino acid-induced target of rapamycin complex 1 (TORC1) kinase signaling, exocytic cargo sorting at endosomes, and epigenetic control of gene expression. This subfamily consists of RagA and RagB as well as RagC and RagD that are closely related. Saccharomyces cerevisiae encodes single orthologs of metazoan RagA/B and RagC/D, Gtr1 and Gtr2, respectively. Dimer formation is important for their cellular function; these domains form heterodimers, as RagA or RagB dimerizes with RagC or RagD, and similarly, Gtr1 dimerizes with Gtr2. In response to amino acids, the Rag GTPases guide the TORC1 complex to activate the platform containing Rheb proto-oncogene by driving the relocalization of mTORC1 from discrete locations in the cytoplasm to a late endosomal and/or lysosomal compartment that is Rheb-enriched and contains Rab-7. Length = 175
>gnl|CDD|206744 cd11384, RagA_like, Rag GTPase, subfamily of Ras-related GTPases, includes Ras-related GTP-binding proteins A and B
RagA and RagB are closely related Rag GTPases (ras-related GTP-binding protein A and B) that constitute a unique subgroup of the Ras superfamily, and are functional homologs of Saccharomyces cerevisiae Gtr1. These domains function by forming heterodimers with RagC or RagD, and similarly, Gtr1 dimerizes with Gtr2, through the carboxy-terminal segments. They play an essential role in regulating amino acid-induced target of rapamycin complex 1 (TORC1) kinase signaling, exocytic cargo sorting at endosomes, and epigenetic control of gene expression. In response to amino acids, the Rag GTPases guide the TORC1 complex to activate the platform containing Rheb proto-oncogene by driving the relocalization of mTORC1 from discrete locations in the cytoplasm to a late endosomal and/or lysosomal compartment that is Rheb-enriched and contains Rab-7. Length = 286
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1
Probab=100.00 E-value=7.7e-38 Score=243.12 Aligned_cols=78 Identities=55% Similarity=0.930 Sum_probs=69.8
Q ss_pred eeEEeecccchhHHHHHHHHHHHHHcCChHHHHHHHHHHHHhcCcceEeeeeccceEEEecCC-CCCC---chhHHHHHH
Q psy9523 18 TLSFHLTSIYDHSIFEAFSKVIQKLIPQLPTLENLLNILINNSGIEKAFLFDVVSKIYIATDS-SPVD---MQSYELCCD 93 (107)
Q Consensus 18 ~i~~~~TSI~D~SLy~AwS~IVq~LiP~~~~le~~L~~~~~~~~aeev~LFe~~T~L~IAtds-~~~D---~~~fE~~sd 93 (107)
+++||+|||||||||+|||+|||+||||++.||++|+.||.+|+|+||||||++||||||||+ +|+| ++|||+|||
T Consensus 151 ~~~~~~TSI~D~Sly~A~S~Ivq~LiP~~~~le~~L~~~~~~c~a~ev~LFd~~T~L~Ia~ds~~~~~~~~~~~fE~~S~ 230 (232)
T PF04670_consen 151 DITFFLTSIWDESLYEAWSKIVQKLIPNLSTLENLLNNFCSSCNADEVFLFDRSTFLYIATDSRSPVDERDMQRFEKCSD 230 (232)
T ss_dssp SEEEEEE-TTSTHHHHHHHHHHHTTSTTHCCCCCCCCHHHCCCTEEEEEEEETTT--ECEE-S-S------HHHHHHHHH
T ss_pred ceEEEeccCcCcHHHHHHHHHHHHHcccHHHHHHHHHHHHHhcCCcEEEEEeeeeEEEEEeccCCCccccccccHHHHhh
Confidence 699999999999999999999999999999999999999999999999999999999999999 8887 999999999
Q ss_pred HH
Q psy9523 94 MV 95 (107)
Q Consensus 94 ~I 95 (107)
||
T Consensus 231 ii 232 (232)
T PF04670_consen 231 II 232 (232)
T ss_dssp HH
T ss_pred cC
Confidence 97
RCC1 catalyzes guanine nucleotide exchange on Ran, a well characterised nuclear Ras-like small G protein that plays an essential role in the import and export of proteins and RNAs across the nuclear membrane through the nuclear pore complex. RCC1 is located inside the nucleus, bound to chromatin. The concentration of GTP within the cell is ~30 times higher than the concentration of GDP, thus resulting in the preferential production of the GTP form of Ran by RCC1 within the nucleus. Gtr1p is located within both the cytoplasm and the nucleus and has been reported to play a role in cell growth. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1 and Rag A and Gtr1p belong to the sixth subfamily of the Ras-like small GTPase superfamily []. ; GO: 0005525 GTP binding, 0005634 nucleus, 0005737 cytoplasm; PDB: 3R7W_B 2Q3F_B 3LLU_A.
