Diaphorina citri psyllid: psy9533


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
MSFVWFQNRRAKWRKKEHTKKGPGRPAHNAHPVTCSGDPIPAEELKRKERARRQKKLMKSLERQVGPLTTPIL
ccEEEEEHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
*SFVWF*N**********************************************************PL*TPI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFVWFQNRRAKWRKKEHTKKGPGRPAHNAHPVTCSGDPIPAEELKRKERARRQKKLMKSLERQVGPLTTPIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein unc-4 homolog Transcription factor involved in somitogenesis and neurogenesis. Required for the maintenance and differentiation of particular elements of the axial skeleton. May act upstream of PAX9. Plays a role in controlling the development of connections of hypothalamic neurons to pituitary elements, allowing central neurons to reach the peripheral blood circulation and to deliver hormones for control of peripheral functions.confidentP97830
Homeobox protein unc-4 homolog Transcription factor involved in somitogenesis and neurogenesis.confidentQ50D79
Homeobox protein unc-4 Transcription factor that regulates synaptic specificity.confidentO77215

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0021516 [BP]dorsal spinal cord developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0021510, GO:0044767, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0001502 [BP]cartilage condensationprobableGO:0032502, GO:0016337, GO:0001501, GO:0009653, GO:0007275, GO:0044699, GO:0048513, GO:0022610, GO:0048705, GO:0009887, GO:0032501, GO:0009987, GO:0009888, GO:0061448, GO:0044767, GO:0044763, GO:0048731, GO:0007155, GO:0051216, GO:0044707, GO:0048856, GO:0008150
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0021889 [BP]olfactory bulb interneuron differentiationprobableGO:0021537, GO:0044707, GO:0030154, GO:0021988, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0048513, GO:0021879, GO:0021872, GO:0021953, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0021772, GO:0022008, GO:0048699, GO:0007420, GO:0007399, GO:0048856, GO:0044763, GO:0030900, GO:0048731
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045595 [BP]regulation of cell differentiationprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0007389 [BP]pattern specification processprobableGO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0035726 [BP]common myeloid progenitor cell proliferationprobableGO:0008150, GO:0044699, GO:0008283
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DMS, chain A
Confidence level:confident
Coverage over the Query: 2-14
View the alignment between query and template
View the model in PyMOL