Diaphorina citri psyllid: psy9553

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280--

MCGPGFNKSNTYLLVSGPPPIFLLDAKLRISSGPPPIFLLDAKLRIPSVVISPPLEEVQEALITAGKHITGVAKGVAQWTGGEAQHITGVAKGVAQWTGGEAQRKKKPSFPLQPRNFYSHVMENKEVVKTLSLLSTCTLDIKPALVSFVEKWSPYKFLWENEMINRRDVTNVGLVESEHALRRHGELEAELNIEPDLHTFGSCIVISVEQLKFGLMTEINSCNRRIAFLLRKKYHREMDYVYAVMNEMDRKLDRTITDLDDVRMIMELLKRIRDQEVDMELKIEPIEEAYNVITRYDLPVDKEDLEQVDSLRYTWQKLLARAMTANVLLTTMQPRFEQDLADNLAQFRQDKVDYCHEYRTSGPMMPGLSPREASDRLILFQNRFDGMWRKLQTYQSGEELFGLPTTDYPELAQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWGEVNIEEINNELMEFQNRCRKLPKGLKEWPAFHALKRTIDDFNDMCPLLELMANKAMKPRHWQRIMEVTKYNFELDSESFCLKNILEAPLLKCKEDIEDICISAMKEKDIEAKLRQVTNEWSVHELTFMTFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVFDLSNTNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVSCCVGDDMLKLLLPHLQEQLELCQKSLSGYLEKKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLSIFDNTKAVRFHEQEYNKMTHIVSSEGETIQLERAVRAEGSVESWLTCLLQMAQQSLHSIIRTAYTSLNDPNFLLLQFLDKMPAQIGILGIQMIWTRDAESALSQARHDKKMMSETNNRFLELLNTLIDQTTRDLTKIERIKFETLITIHVHQRDIFDILGPEEVQWLTRKTTCIHTLMAALSEVEEPHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKPGDHVWLVLDGPVDSIWIENLNSVLDDNRTLTLANGDRLSMALAVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDWSPIVAAWLRGRSAKEASVFHHLFEESFPVLYAWGAANLSYVMKVLQVNYVQQMLILLQGLVPTSTPTVTEAESTEEGGAPSPAPLEEDEEAKSEQDLCTKLSPEHLHRLYVFALVWGMGAFLELPGRVKFDLFLREKLATLLDLPSNAGDPQATVFDFYVNDEGGWEPWSSMVNTYSYPENSTPDYSSILVPIADNVRIDYLVNCIAKQEHAVLLIGESGKL

ccccHHHHHHHHHHHHcccHHHHHHHHcccccccccEEEEEEEEEcccEEECccHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccEEccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHHHHccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccEECccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccHHHHHHHHHHHccccccEEcccccccEEEEEcccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHcccccccEEECccccccccccccEEEEEccccccccccccccccEEEEccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHcccEEEEEcccccc

MCGPGFNKSNTYLLVSGPPPIFLLDAKLRISSGPPPIFLLDAKLRIPSVVISPPLEEVQEALITAGKHITGVAKGVAQWTGGEAQHITGVAKGVA***************PLQPRNFYSHVMENKEVVKTLSLLSTCTLDIKPALVSFVEKWSPYKFLWENEMINRRDVTNVGLVESEHALRRHGELEAELNIEPDLHTFGSCIVISVEQLKFGLMTEINSCNRRIAFLLRKKYHREMDYVYAVMNEMDRKLDRTITDLDDVRMIMELLKRIRDQEVDMELKIEPIEEAYNVITRYDLPVDKEDLEQVDSLRYTWQKLLARAMTANVLLTTMQPRFEQDLADNLAQFRQDKVDYCHEYRTSGPMMPGLSPREASDRLILFQNRFDGMWRKLQTYQSGEELFGLPTTDYPELAQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWGEVNIEEINNELMEFQNRCRKLPKGLKEWPAFHALKRTIDDFNDMCPLLELMANKAMKPRHWQRIMEVTKYNFELDSESFCLKNILEAPLLKCKEDIEDICISAMKEKDIEAKLRQVTNEWSVHELTFMTFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVFDLSNTNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVSCCVGDDMLKLLLPHLQEQLELCQKSLSGYLEKKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLSIFDNTKAVRFHEQEYNKMTHIVSSEGETIQLERAVRAEGSVESWLTCLLQMAQQSLHSIIRTAYTSLNDPNFLLLQFLDKMPAQIGILGIQMIWTRDAESALSQARHDKKMMSETNNRFLELLNTLIDQTTRDLTKIERIKFETLITIHVHQRDIFDILGPEEVQWLTRKTTCIHTLMAALSEVEEPHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKPGDHVWLVLDGPVDSIWIENLNSVLDDNRTLTLANGDRLSMALAVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDWSPIVAAWLRGRSAKEASVFHHLFEESFPVLYAWGAANLSYVMKVLQVNYVQQMLILLQGLVPTSTPTVTEAESTEEGGAPSPAPLEEDEE*KS**DLCTKLSPEHLHRLYVFALVWGMGAFLELPGRVKFDLFLREKLATLLDLPSNAGDPQATVFDFYVNDEGGWEPWSSMVNTYSYPENSTPDYSSILVPIADNVRIDYLVNCIAKQEHAVLLIGESG**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dynein heavy chain 5, axonemal	Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Required for structural and functional integrity of the cilia of ependymal cells lining the brain ventricles.	confident	Q8VHE6
Dynein heavy chain 5, axonemal	Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Required for structural and functional integrity of the cilia of ependymal cells lining the brain ventricles.	confident	Q8TE73

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0042995 [CC]	cell projection	probable	GO:0005575, GO:0044464, GO:0005623
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007605 [BP]	sensory perception of sound	probable	GO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VKH, chain A
Confidence level:confident
Coverage over the Query: 538-920
View the alignment between query and template
View the model in PyMOL

Template: 1U4Q, chain A
Confidence level:probable
Coverage over the Query: 232-436
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3vkg, chain A		very confident	Alignment \| Template Structure