Diaphorina citri psyllid: psy9563


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MNMKGFYSLEKPGEFTTLIDVQFVAAMAQPGGGRNDIPSRLKRQFCIFNCVLPSDKAIDNIFSVIGEGHYNAKRGFPIEVRNLVKQLIPLTRLLWKSTRAQLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVIDSEKVLMLLWKHEVTRVFSDRFTIMSDKHWFDDEVLNLVEQNLGVKYREMAGTDPVFVD
ccccccccccccccccEEcccEEEEcccccccccccccHHHHHHHcEEEcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHccccccccc
MNMKGFYSLEKPGEFTTLIDVQFVAAMAQPGGGRNDIPSRLKRQFCIFNCVLPSDKAIDNIFSVIGEGHYNAKRGFPIEVRNLVKQLIPLTRLLWKSTRAQLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVIDSEKVLMLLWKHEVTRVFSDRFTIMSDKHWFDDEVLNLVEQNLGVKYREMAGTDPVFVD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNMKGFYSLEKPGEFTTLIDVQFVAAMAQPGGGRNDIPSRLKRQFCIFNCVLPSDKAIDNIFSVIGEGHYNAKRGFPIEVRNLVKQLIPLTRLLWKSTRAQLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVIDSEKVLMLLWKHEVTRVFSDRFTIMSDKHWFDDEVLNLVEQNLGVKYREMAGTDPVFVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynein heavy chain 5, axonemal Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Required for structural and functional integrity of the cilia of ependymal cells lining the brain ventricles.confidentQ8VHE6
Dynein heavy chain 5, axonemal Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Required for structural and functional integrity of the cilia of ependymal cells lining the brain ventricles.confidentQ8TE73

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031514 [CC]motile ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0005930 [CC]axonemeprobableGO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VKG, chain A
Confidence level:very confident
Coverage over the Query: 20-173
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3vkg, chain A very confident Alignment | Template Structure