Diaphorina citri psyllid: psy9567

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MFLRCTVVSEKMFLRRCTEMGYVNFTWKSGMKKYYYNFDRLQSFNENILEPPSVSIKTTGRIPRRPKVFSIQLKCSGNRSGIASFTIGLLIESRKGKPLPGTPLRLKLRKECAERMCYRLFP
ccEEEEEEEEEEEEEccccccEEEEEEEEccccccEEEEEEECcccccccccccccccccccccccEEcEEEEECcccccEEEEEEEEEEEEEccccccccccCEEEEEccccccccccccc
*FLRCTVVSEKMFLRRCTEMGYVNFTWKSGMKKYYYNFDRLQSFNENILEPPSVSIKTTGRIPRRPKVFSIQLKCSGNRSGIASFTIGLLIESRKGKPLPGTPLRLKLRKECAERMCYRLFP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLRCTVVSEKMFLRRCTEMGYVNFTWKSGMKKYYYNFDRLQSFNENILEPPSVSIKTTGRIPRRPKVFSIQLKCSGNRSGIASFTIGLLIESRKGKPLPGTPLRLKLRKECAERMCYRLFP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein shifted Required for normal accumulation and movement of lipid-modified hedgehog (hh) morphogen. May act by stabilizing the interaction between heparan sulfate proteoglycans (HSPGs) and hh, HSPGs being required for diffusion of hh morphogen. Not involved in wingless (wg) morphogen movement, suggesting that it may provide HSPG specificity for Hh.confidentQ9W3W5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005578 [CC]proteinaceous extracellular matrixprobableGO:0005575, GO:0005576, GO:0044421, GO:0031012

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YGO, chain A
Confidence level:very confident
Coverage over the Query: 5-117
View the alignment between query and template
View the model in PyMOL