Diaphorina citri psyllid: psy9569


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MFRALASRLAASSSQVLRQTAVSKVKPLTFAPIRSFSHAVEESDEEFVKRYVAFFNQPDIDGWDIRRGLMNLAHDDCVPDPEIIIAALKAIRRVNDYALAIRFLETTEFKTGGSHDKIWPYIVQEITPTLKELGIETPAQLGYDKPELALESVYDM
cHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccc
MFR******A*******************************ESDEEFVKRYVAFFNQPDIDGWDIRRGLMNLAHDDCVPDPEIIIAALKAIRRVNDYALAIRFLETTEFKTGGSHDKIWPYIVQEITPTLKELGIETPAQLGYDKPELALESVYDM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRALASRLAASSSQVLRQTAVSKVKPLTFAPIRSFSHAVEESDEEFVKRYVAFFNQPDIDGWDIRRGLMNLAHDDCVPDPEIIIAALKAIRRVNDYALAIRFLETTEFKTGGSHDKIWPYIVQEITPTLKELGIETPAQLGYDKPELALESVYDM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c oxidase subunit 5A, mitochondrial This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.very confidentQ94514
Cytochrome c oxidase subunit 5A, mitochondrial This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.confidentP00426
Cytochrome c oxidase subunit 5A, mitochondrial This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.confidentQ53CF8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0045787 [BP]positive regulation of cell cycleprobableGO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0021522 [BP]spinal cord motor neuron differentiationprobableGO:0032502, GO:0032501, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0021515, GO:0048869, GO:0021517, GO:0030154, GO:0021510, GO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0044707, GO:0048731, GO:0022008, GO:0007275, GO:0021953, GO:0007417
GO:0048568 [BP]embryonic organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0004129 [MF]cytochrome-c oxidase activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0022857, GO:0015075, GO:0003824, GO:0015077, GO:0016676, GO:0016675, GO:0003674, GO:0015078, GO:0015002, GO:0016491
GO:0006123 [BP]mitochondrial electron transport, cytochrome c to oxygenprobableGO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0009055 [MF]electron carrier activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y69, chain E
Confidence level:very confident
Coverage over the Query: 42-146
View the alignment between query and template
View the model in PyMOL