Diaphorina citri psyllid: psy9570

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MLSSTFRVNQQGFRLVRNLHQKRVSRQLDEIIRVDHAGELGADRIYAGQMAVLGNSSVAPKIQEMWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFILGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIEHGAEQAPFYKLMTDVIKVGCKVAIGVAK
cccccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcHHHHcccc
**********QGFRLVRNLHQKRVSRQLDEIIRVDHAGELGADRIYAGQMAVLGNSSVAPKIQEMWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFILGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGL*HGAEQAPFYKLMTDVIKVGCKVAIEHGAEQAPFYKLMTDVIKVGCKVAIGVA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSSTFRVNQQGFRLVRNLHQKRVSRQLDEIIRVDHAGELGADRIYAGQMAVLGNSSVAPKIQEMWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFILGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIEHGAEQAPFYKLMTDVIKVGCKVAIGVAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquinone biosynthesis protein COQ7 homolog Plays a role in biological timing and in longevity.very confidentP48376
Ubiquinone biosynthesis protein COQ7 homolog Potential central metabolic regulator.very confidentQ54VB3
Ubiquinone biosynthesis protein coq7 Involved in one or more monooxygenase steps of ubiquinone biosynthesis.confidentO74826

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000975 [MF]regulatory region DNA bindingconfidentGO:0097159, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030534 [BP]adult behaviorprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0048520 [BP]positive regulation of behaviorprobableGO:0048584, GO:0048583, GO:0050795, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0070584 [BP]mitochondrion morphogenesisprobableGO:0006996, GO:0032502, GO:0009987, GO:0032990, GO:0048869, GO:0071840, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0044699, GO:0008150, GO:0009653, GO:0007005
GO:0001306 [BP]age-dependent response to oxidative stressprobableGO:0032502, GO:0007571, GO:0007568, GO:0050896, GO:0044767, GO:0006950, GO:0008150, GO:0006979, GO:0044699
GO:0044351 [BP]macropinocytosisprobableGO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0046914 [MF]transition metal ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0001841 [BP]neural tube formationprobableGO:0048598, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009792, GO:0035239, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0043009, GO:0048646, GO:0032502, GO:0032501, GO:0021915, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0001838, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0071276 [BP]cellular response to cadmium ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0046686, GO:0042221, GO:0010035, GO:0044699
GO:0071585 [BP]detoxification of cadmium ionprobableGO:0050896, GO:0009636, GO:0008150, GO:0010038, GO:0046686, GO:0042221, GO:0010035
GO:0034599 [BP]cellular response to oxidative stressprobableGO:0051716, GO:0033554, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0070887, GO:0042221, GO:0006979, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0016491 [MF]oxidoreductase activityprobableGO:0003824, GO:0003674
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0006744 [BP]ubiquinone biosynthetic processprobableGO:0006732, GO:0006733, GO:0044249, GO:0009108, GO:0044281, GO:0044283, GO:0045426, GO:1901576, GO:0044710, GO:0051186, GO:1901663, GO:0051188, GO:1901661, GO:0042375, GO:0071704, GO:0006743, GO:0009987, GO:0009058, GO:0044711, GO:0008150, GO:0008152, GO:0042181, GO:0042180, GO:0044237
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0042775 [BP]mitochondrial ATP synthesis coupled electron transportprobableGO:0044710, GO:0009987, GO:0015980, GO:0016310, GO:0006793, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042773, GO:0055114, GO:0006119

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FZF, chain A
Confidence level:confident
Coverage over the Query: 27-163
View the alignment between query and template
View the model in PyMOL
Template: 2C2U, chain A
Confidence level:probable
Coverage over the Query: 12-162
View the alignment between query and template
View the model in PyMOL