Diaphorina citri psyllid: psy9578


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MPRVKRGVTARARHKKVLKQAKGYFGRRNSVYRVAKQAVMHAMQYAYRDRRNKKRVFRSLWISRINAAVREHKMTYNTFMNGLKKSSIQLDRKLLASIAITDKLVFSSIVNQIKENLTNKAF
cccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHcHHHHHHHHHHcHHHHHHHHHHHHHHHccccc
*******V*ARARHKKVLKQAKGYFGRRNSVYRVAKQAVMHAMQYAYRDRRNKKRVFRSLWISRINAAVREHKMTYNTFMNGLKKSSIQLDRKLLASIAITDKLVFSSIVNQIKENLT****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRVKRGVTARARHKKVLKQAKGYFGRRNSVYRVAKQAVMHAMQYAYRDRRNKKRVFRSLWISRINAAVREHKMTYNTFMNGLKKSSIQLDRKLLASIAITDKLVFSSIVNQIKENLTNKAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L20 Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.very confidentQ13WG0
50S ribosomal protein L20 Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.very confidentQ3JT10
50S ribosomal protein L20 Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.very confidentA1V3R0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000027 [BP]ribosomal large subunit assemblyconfidentGO:0042273, GO:0006996, GO:0071826, GO:0022607, GO:0043933, GO:0009987, GO:0042255, GO:0042254, GO:0016043, GO:0065003, GO:0022618, GO:0044763, GO:0044699, GO:0034622, GO:0022613, GO:0008150, GO:0070925, GO:0071840, GO:0044085
GO:0000900 [MF]translation repressor activity, nucleic acid bindingconfidentGO:0090079, GO:0003676, GO:0097159, GO:0030371, GO:0003674, GO:0005488, GO:0045182, GO:1901363
GO:0022625 [CC]cytosolic large ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0000315 [CC]organellar large ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0015934, GO:0005840, GO:0043232, GO:0043229, GO:0044464, GO:0000313, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0030529, GO:0043226, GO:0044422
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019843 [MF]rRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005761 [CC]mitochondrial ribosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0030529, GO:0005759, GO:0000313, GO:0043231, GO:0032991, GO:0005840, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R8S, chain Q
Confidence level:very confident
Coverage over the Query: 2-118
View the alignment between query and template
View the model in PyMOL