Diaphorina citri psyllid: psy9585


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MTDNHFVHKKRSNVLTRVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENGK
cccccccccccccccccccccHHHHHcccccHHHHHHHcccccHHHHHHHHHHcHHHHHHHcccccccEEccccccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEcccccccccHHHHHHHHHccccccEEccccccccccccc
*****F*HKKR******VFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDNHFVHKKRSNVLTRVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box/LRR-repeat protein 2 Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation. Binds to hepatitis C virus non-structural protein 5A (NS5A) in a reaction crucial for hepatitis C virus RNA replication.confidentQ9UKC9
Uncharacterized F-box/LRR-repeat protein C02F5.7 confidentP34284
F-box/LRR-repeat protein 2 Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.confidentA6H779

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0016020 [CC]membraneprobableGO:0005575
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 82-188
View the alignment between query and template
View the model in PyMOL
Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 28-181
View the alignment between query and template
View the model in PyMOL