Psyllid ID: psy9585


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MTDNHFVHKKRSNVLTRVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENGK
cccccccccccccccccccccHHHHHcccccHHHHHHHcccccHHHHHHHHHHcHHHHHHHHccccccEEccccccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEcccccccccHHHHHHHHHccccccEEccccccccccccc
ccccccccccccccccccccccccccHHcccHHHHHHHHHcccHHHHHHHHcccHHHHHHHccHHHccEEEcccccccccHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEcccccccccccc
mtdnhfvhkkrsnvltrVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILAldgsnwsridlfnfqtdvegpvlenISRRCGGFLRqislrgcqsmtdNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENGK
mtdnhfvhkkrsnvltrvfledealinkklpkeLLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLthiniswcinitengk
MTDNHFVHKKRSNVLTRVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENGK
***********SNVLTRVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINIT****
MTDNHF*HKKR*******FLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITE***
********KKRSNVLTRVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENGK
*****FVHKK*******VFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINIT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDNHFVHKKRSNVLTRVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q9UKC9 423 F-box/LRR-repeat protein yes N/A 0.878 0.392 0.676 7e-64
A6H779 423 F-box/LRR-repeat protein yes N/A 0.878 0.392 0.670 2e-63
Q5R3Z8 423 F-box/LRR-repeat protein yes N/A 0.878 0.392 0.670 4e-63
Q8BH16 423 F-box/LRR-repeat protein yes N/A 0.867 0.387 0.658 4e-63
Q96IG2 436 F-box/LRR-repeat protein no N/A 0.878 0.380 0.676 2e-62
Q58DG6 436 F-box/LRR-repeat protein no N/A 0.878 0.380 0.676 2e-62
Q9CZV8 436 F-box/LRR-repeat protein no N/A 0.878 0.380 0.670 6e-62
Q9QZH7276 F-box/LRR-repeat protein no N/A 0.878 0.601 0.670 7e-62
P34284 466 Uncharacterized F-box/LRR yes N/A 0.873 0.354 0.520 9e-50
Q9UF56 701 F-box/LRR-repeat protein no N/A 0.835 0.225 0.341 6e-19
>sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 Back     alignment and function desciption
 Score =  243 bits (619), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 113/167 (67%), Positives = 140/167 (83%)

Query: 22  DEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEG 81
           DE LINKKLPKELLLRIFS+LD+ +LCRCAQ+SKAWNILALDGSNW RIDLFNFQTDVEG
Sbjct: 7   DEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEG 66

Query: 82  PVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALS 141
            V+ENIS+RCGGFLR++SLRGC  + D+SL   AQ C N+E +NLN C K+TD+T  +LS
Sbjct: 67  RVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS 126

Query: 142 KHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENG 188
           + C+KL+ LDL SC  IT+ SLK +++GCRNL ++N+SWC  IT++G
Sbjct: 127 RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDG 173




Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation. Binds to hepatitis C virus non-structural protein 5A (NS5A) in a reaction crucial for hepatitis C virus RNA replication.
Homo sapiens (taxid: 9606)
>sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 Back     alignment and function description
>sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 Back     alignment and function description
>sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 Back     alignment and function description
>sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 Back     alignment and function description
>sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 Back     alignment and function description
>sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=4 SV=3 Back     alignment and function description
>sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
270006862 861 hypothetical protein TcasGA2_TC013252 [T 0.915 0.200 0.775 1e-75
189237655 433 PREDICTED: similar to AGAP007807-PA [Tri 0.915 0.399 0.775 1e-74
328696965 455 PREDICTED: f-box/LRR-repeat protein 20-l 0.915 0.380 0.729 9e-70
307180560 458 F-box/LRR-repeat protein 20 [Camponotus 0.904 0.373 0.735 4e-69
345491289 435 PREDICTED: F-box/LRR-repeat protein 20-l 0.968 0.420 0.706 4e-69
332025721 427 F-box/LRR-repeat protein 20 [Acromyrmex 0.904 0.400 0.735 8e-69
383857505 516 PREDICTED: F-box/LRR-repeat protein 20-l 0.899 0.329 0.735 1e-68
345491287 515 PREDICTED: F-box/LRR-repeat protein 20-l 0.904 0.332 0.735 2e-68
340723816 435 PREDICTED: f-box/LRR-repeat protein 20-l 0.968 0.420 0.690 1e-67
350424926 513 PREDICTED: F-box/LRR-repeat protein 20-l 0.915 0.337 0.718 4e-67
>gi|270006862|gb|EFA03310.1| hypothetical protein TcasGA2_TC013252 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 135/174 (77%), Positives = 152/174 (87%)

Query: 15  LTRVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFN 74
           LT+V  +DEALINKKLPKELLLRIFSY+DV SLCRCAQVSKAWN+LALDGSNW RIDLF+
Sbjct: 438 LTKVLSDDEALINKKLPKELLLRIFSYIDVVSLCRCAQVSKAWNVLALDGSNWQRIDLFD 497

Query: 75  FQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTD 134
           FQ DVEGP++ENISRRCGGFLRQ+SLRGCQS+ D S+  LAQ C NVED+NLN CKKLTD
Sbjct: 498 FQKDVEGPIIENISRRCGGFLRQLSLRGCQSIADGSMKTLAQLCPNVEDLNLNGCKKLTD 557

Query: 135 ATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENG 188
           A+  A SKHC+KLQ+L+L  CS ITD SLKAL+DGC NLTHINISW  N+TENG
Sbjct: 558 ASCTAFSKHCSKLQKLNLDGCSAITDNSLKALSDGCPNLTHINISWSNNVTENG 611




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189237655|ref|XP_001812041.1| PREDICTED: similar to AGAP007807-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328696965|ref|XP_001945889.2| PREDICTED: f-box/LRR-repeat protein 20-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307180560|gb|EFN68516.1| F-box/LRR-repeat protein 20 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345491289|ref|XP_001603165.2| PREDICTED: F-box/LRR-repeat protein 20-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332025721|gb|EGI65879.1| F-box/LRR-repeat protein 20 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383857505|ref|XP_003704245.1| PREDICTED: F-box/LRR-repeat protein 20-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345491287|ref|XP_003426564.1| PREDICTED: F-box/LRR-repeat protein 20-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340723816|ref|XP_003400284.1| PREDICTED: f-box/LRR-repeat protein 20-like isoform 1 [Bombus terrestris] gi|350424929|ref|XP_003493958.1| PREDICTED: F-box/LRR-repeat protein 20-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350424926|ref|XP_003493957.1| PREDICTED: F-box/LRR-repeat protein 20-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
UNIPROTKB|F1NHD2 423 FBXL2 "Uncharacterized protein 0.883 0.394 0.688 6.9e-63
UNIPROTKB|F1PWK1 422 FBXL2 "Uncharacterized protein 0.883 0.395 0.676 1.6e-61
UNIPROTKB|Q9UKC9 423 FBXL2 "F-box/LRR-repeat protei 0.883 0.394 0.676 1.6e-61
UNIPROTKB|A6H779 423 FBXL2 "F-box/LRR-repeat protei 0.883 0.394 0.670 5.5e-61
UNIPROTKB|Q5R3Z8 423 FBXL2 "F-box/LRR-repeat protei 0.883 0.394 0.670 7.1e-61
MGI|MGI:1919429 423 Fbxl2 "F-box and leucine-rich 0.883 0.394 0.658 7.1e-61
RGD|1562243 422 Fbxl2 "F-box and leucine-rich 0.883 0.395 0.658 7.1e-61
UNIPROTKB|Q58DG6 436 FBXL20 "F-box/LRR-repeat prote 0.883 0.383 0.676 3.9e-60
UNIPROTKB|Q96IG2 436 FBXL20 "F-box/LRR-repeat prote 0.883 0.383 0.676 3.9e-60
MGI|MGI:1919444 436 Fbxl20 "F-box and leucine-rich 0.883 0.383 0.670 1.3e-59
UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 642 (231.1 bits), Expect = 6.9e-63, P = 6.9e-63
 Identities = 115/167 (68%), Positives = 141/167 (84%)

Query:    22 DEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEG 81
             DEALINKKLPKELLLRIFS+LD+ +LCRCAQVSKAWN+LALDGSNW +IDLFNFQTD+EG
Sbjct:     7 DEALINKKLPKELLLRIFSFLDIVTLCRCAQVSKAWNVLALDGSNWQKIDLFNFQTDIEG 66

Query:    82 PVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALS 141
              V+ENIS+RCGGFLRQ+SLRGC  + D+SL   AQ C N+E +NLN C K+TD+T  +LS
Sbjct:    67 RVVENISKRCGGFLRQLSLRGCHVVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS 126

Query:   142 KHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENG 188
             + C+KL+ LDL SC  IT+ SLK L++GCRNL H+N+SWC  IT++G
Sbjct:   127 RFCSKLKHLDLTSCVAITNSSLKGLSEGCRNLEHLNLSWCDQITKDG 173


GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0006513 "protein monoubiquitination" evidence=IEA
GO:0016020 "membrane" evidence=IEA
UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9UKC9FBXL2_HUMANNo assigned EC number0.67660.87830.3924yesN/A
A6H779FBXL2_BOVINNo assigned EC number0.67060.87830.3924yesN/A
Q5R3Z8FBXL2_PONABNo assigned EC number0.67060.87830.3924yesN/A
Q8BH16FBXL2_MOUSENo assigned EC number0.65860.86770.3877yesN/A
P34284YKK7_CAEELNo assigned EC number0.52090.87300.3540yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
pfam1293747 pfam12937, F-box-like, F-box-like 7e-14
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 6e-11
cd09293 226 cd09293, AMN1, Antagonist of mitotic exit network 4e-10
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 3e-07
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 2e-06
pfam0064648 pfam00646, F-box, F-box domain 9e-06
smart0036726 smart00367, LRR_CC, Leucine-rich repeat - CC (cyst 6e-04
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
 Score = 62.5 bits (153), Expect = 7e-14
 Identities = 23/44 (52%), Positives = 27/44 (61%)

Query: 29 KLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDL 72
           LP E+LL+IFSYLD   L R A V + W  LA D S W R+ L
Sbjct: 3  DLPDEILLQIFSYLDPRDLLRLALVCRRWRELASDDSLWRRLCL 46


This is an F-box-like family. Length = 47

>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
KOG4341|consensus 483 99.94
KOG2120|consensus 419 99.89
KOG4341|consensus483 99.52
KOG2120|consensus419 99.39
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 99.32
KOG1947|consensus 482 99.28
KOG1947|consensus 482 99.2
KOG3864|consensus221 98.88
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.8
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.55
KOG3864|consensus221 98.35
KOG1909|consensus 382 98.13
KOG3665|consensus 699 98.1
KOG3207|consensus 505 98.03
KOG1909|consensus382 97.95
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 97.95
KOG3665|consensus 699 97.67
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 97.65
KOG2997|consensus366 97.42
KOG0281|consensus 499 97.41
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.08
KOG3207|consensus 505 97.06
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.72
PLN03215 373 ascorbic acid mannose pathway regulator 1; Provisi 96.69
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.69
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.49
KOG2739|consensus260 96.4
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.4
KOG0618|consensus 1081 96.35
KOG2123|consensus 388 96.32
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.05
PLN03150623 hypothetical protein; Provisional 96.05
KOG2982|consensus 418 95.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.79
KOG2739|consensus 260 95.64
KOG2982|consensus 418 95.58
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.54
KOG2123|consensus 388 94.67
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 94.57
PLN03150 623 hypothetical protein; Provisional 94.52
KOG4194|consensus 873 94.32
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 94.3
KOG3763|consensus 585 94.17
KOG4194|consensus 873 94.16
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.94
PF13013109 F-box-like_2: F-box-like domain 93.53
KOG1859|consensus 1096 93.52
KOG0472|consensus565 93.48
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.13
KOG1644|consensus233 91.52
KOG0444|consensus 1255 91.22
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 91.16
KOG0444|consensus 1255 91.04
KOG0274|consensus 537 90.98
PF0937297 PRANC: PRANC domain; InterPro: IPR018272 This pres 90.91
KOG1644|consensus 233 87.7
PRK15386 426 type III secretion protein GogB; Provisional 86.43
KOG1259|consensus 490 85.19
KOG0618|consensus 1081 84.97
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 84.91
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 84.67
KOG3926|consensus332 84.45
KOG4237|consensus 498 83.27
KOG1259|consensus 490 83.24
KOG4658|consensus 889 82.57
KOG4308|consensus 478 82.34
KOG4579|consensus177 81.23
KOG3735|consensus353 80.84
KOG4658|consensus 889 80.04
>KOG4341|consensus Back     alignment and domain information
Probab=99.94  E-value=8.4e-28  Score=184.87  Aligned_cols=164  Identities=55%  Similarity=1.006  Sum_probs=157.9

Q ss_pred             hhcCCCCHHHHHHHHhcCChhhhHHHhhhhHHHHHhhhCCCCcceeeccCCCCCCCHHHHHHHHHHcCCCccEEeecCCC
Q psy9585          25 LINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQ  104 (189)
Q Consensus        25 ~~~~~LP~~il~~I~~~L~~~~~~~~~~v~~~w~~~~~~~~~~~~~~l~~~~~~~~~~~l~~l~~~~~~~L~~L~l~~~~  104 (189)
                      ..--.||.|++.+||++|+.+.+.+++++|+.|...+.|...|.++|+..+..+++..++..+.++|+..|++|.++||.
T Consensus        70 ~~~~~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG~r  149 (483)
T KOG4341|consen   70 SISRSLPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRGCR  149 (483)
T ss_pred             cccccCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhccccccccccccc
Confidence            33457999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHcCCCcceEecccCCCCCHHHHHHHHHcCCCCCEEecCCCCCCCHHHHHHHHhcCCCCCeeecccCcCc
Q psy9585         105 SMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINI  184 (189)
Q Consensus       105 ~~~~~~l~~l~~~~~~L~~L~l~~~~~i~~~~~~~l~~~~~~L~~L~L~~c~~i~~~~l~~l~~~~~~L~~L~l~~c~~l  184 (189)
                      .+.+..+..+...||+++.|.+.+|.++|+..+..+.+.|++|++|+|..|..+|+..++.++++||+|++|+++||+.+
T Consensus       150 ~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi  229 (483)
T KOG4341|consen  150 AVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQI  229 (483)
T ss_pred             cCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCC
Q psy9585         185 TENG  188 (189)
Q Consensus       185 t~~~  188 (189)
                      +++|
T Consensus       230 ~~~g  233 (483)
T KOG4341|consen  230 SGNG  233 (483)
T ss_pred             hcCc
Confidence            8865



>KOG2120|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG2997|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3926|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG3735|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1fqv_A 336 Insights Into Scf Ubiquitin Ligases From The Struct 2e-11
1fs2_A 272 Insights Into Scf Ubiquitin Ligases From The Struct 2e-10
>pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336 Back     alignment and structure

Iteration: 1

Score = 65.5 bits (158), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 61/175 (34%), Positives = 90/175 (51%), Gaps = 21/175 (12%) Query: 30 LPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLF--NFQTDVEGPVLEN- 86 LP ELLL IFS L + L + + V K W LA D S W +DL N DV G +L Sbjct: 12 LPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQG 71 Query: 87 -ISRRCG-GFLRQ-----ISLRGCQSM-TDNSL-------NILAQYCNNVEDINLNLCKK 131 I+ RC F+ Q S Q M NS+ IL+Q C+ +++++L + Sbjct: 72 VIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQ-CSKLQNLSLE-GLR 129 Query: 132 LTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITE 186 L+D L+K+ + L RL+L+ CS ++ +L+ L C L +N+SWC + TE Sbjct: 130 LSDPIVNTLAKN-SNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTE 183
>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 2e-34
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-19
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-16
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-12
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-28
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-17
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-16
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-11
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-24
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-14
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-14
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-13
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-12
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-09
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-07
3l2o_B 312 F-box only protein 4; small G protein fold, UBL co 2e-20
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 5e-16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-12
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-11
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 7e-10
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 3e-09
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 8e-09
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 8e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 7e-04
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
 Score =  123 bits (309), Expect = 2e-34
 Identities = 54/178 (30%), Positives = 84/178 (47%), Gaps = 19/178 (10%)

Query: 28  KKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLF--NFQTDVEGPVLE 85
             LP ELLL IFS L +  L + + V K W  LA D S W  +DL   N   DV G +L 
Sbjct: 10  DSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLS 69

Query: 86  N--ISRRCGGFLRQISLRGCQS-------------MTDNSLNILAQYCNNVEDINLNLCK 130
              I+ RC        L    S             +  ++L+ +   C+ +++++L   +
Sbjct: 70  QGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLR 129

Query: 131 KLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENG 188
            L+D     L+K+   L RL+L+ CS  ++ +L+ L   C  L  +N+SWC + TE  
Sbjct: 130 -LSDPIVNTLAKNS-NLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKH 185


>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.75
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.73
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.55
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.38
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.35
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.27
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.15
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.1
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.99
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.95
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.82
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.78
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.66
3l2o_B 312 F-box only protein 4; small G protein fold, UBL co 98.61
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.58
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.58
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.56
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.48
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.47
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.38
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.28
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.18
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.02
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.0
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.94
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.82
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.73
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.72
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.6
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.51
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.48
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.37
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.0
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.0
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 96.99
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 96.94
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 96.94
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.94
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 96.94
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 96.91
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 96.91
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 96.9
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 96.9
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.9
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 96.89
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 96.85
1o6v_A466 Internalin A; bacterial infection, extracellular r 96.84
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.78
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 96.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 96.78
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 96.76
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 96.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.71
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 96.7
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 96.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 96.65
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 96.65
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 96.65
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 96.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 96.64
3m19_A 251 Variable lymphocyte receptor A diversity region; a 96.62
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 96.61
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 96.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 96.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.61
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 96.61
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 96.59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 96.58
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 96.56
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 96.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 96.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 96.53
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 96.51
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 96.51
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 96.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.48
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 96.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.44
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 96.44
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 96.42
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 96.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.41
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 96.4
3e6j_A229 Variable lymphocyte receptor diversity region; var 96.4
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 96.34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 96.34
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.32
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 96.31
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 96.31
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 96.3
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.27
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 96.27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 96.26
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.26
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 96.26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 96.25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 96.24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 96.24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 96.24
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.23
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 96.23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 96.22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 96.2
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 96.14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 96.14
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 96.08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 96.05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 96.04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.03
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 95.96
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 95.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 95.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 95.94
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 95.93
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 95.91
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 95.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 95.86
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 95.85
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 95.85
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 95.84
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 95.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 95.58
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 95.54
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 95.39
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 95.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 94.86
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 94.79
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 94.72
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 94.61
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 94.47
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 94.26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 94.14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 93.37
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 92.22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 91.84
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 91.69
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 91.41
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 90.92
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 90.36
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 89.5
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.89  E-value=4.9e-22  Score=153.90  Aligned_cols=156  Identities=30%  Similarity=0.472  Sum_probs=99.8

Q ss_pred             hhhcCCCCHHHHHHHHhcCChhhhHHHhhhhHHHHHhhhCCCCcceeeccCCCC--------------------------
Q psy9585          24 ALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQT--------------------------   77 (189)
Q Consensus        24 ~~~~~~LP~~il~~I~~~L~~~~~~~~~~v~~~w~~~~~~~~~~~~~~l~~~~~--------------------------   77 (189)
                      ...|++||+|++.+||+||+..|+.+++.||++|++++.++..|+.++++....                          
T Consensus         6 ~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~~~   85 (336)
T 2ast_B            6 GVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQP   85 (336)
T ss_dssp             -CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEECSC
T ss_pred             cCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCCHHHHHhhhhccceEEEcCCcccccc
Confidence            456999999999999999999999999999999999998888899988764310                          


Q ss_pred             ------------------CCCHHHHHHHHHHcCCCccEEeecCCCCCCHHHHHHHHHcCCCcceEecccCCCCCHHHHHH
Q psy9585          78 ------------------DVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLA  139 (189)
Q Consensus        78 ------------------~~~~~~l~~l~~~~~~~L~~L~l~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~i~~~~~~~  139 (189)
                                        .+++..+..+...+++ |++|+++++ .+++.....+. .+++|++|++++|..+++.++..
T Consensus        86 ~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~-L~~L~L~~~-~l~~~~~~~l~-~~~~L~~L~L~~~~~l~~~~l~~  162 (336)
T 2ast_B           86 LAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSK-LQNLSLEGL-RLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQT  162 (336)
T ss_dssp             CCSCCCCBCCCEEECTTCEECHHHHHHHHTTBCC-CSEEECTTC-BCCHHHHHHHT-TCTTCSEEECTTCBSCCHHHHHH
T ss_pred             chhhccCCCCCEEEccCCCcCHHHHHHHHhhCCC-CCEEeCcCc-ccCHHHHHHHh-cCCCCCEEECCCCCCCCHHHHHH
Confidence                              1122334444445543 666666654 34444444333 35566666666554555555555


Q ss_pred             HHHcCCCCCEEecCCCCCCCHHHHHHHHhcCC-CCCeeecccCc
Q psy9585         140 LSKHCAKLQRLDLASCSFITDQSLKALADGCR-NLTHINISWCI  182 (189)
Q Consensus       140 l~~~~~~L~~L~L~~c~~i~~~~l~~l~~~~~-~L~~L~l~~c~  182 (189)
                      +...+++|++|+|++|..+++.++..+...+| +|++|++++|.
T Consensus       163 ~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~  206 (336)
T 2ast_B          163 LLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYR  206 (336)
T ss_dssp             HHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCG
T ss_pred             HHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCc
Confidence            55555566666666553455555444444455 55555555553



>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 4e-12
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 4e-12
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 5e-10
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 1e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD-repeat protein 1 (beta-TRCP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 58.2 bits (140), Expect = 4e-12
 Identities = 17/57 (29%), Positives = 23/57 (40%)

Query: 28 KKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVL 84
           +    +   I SYLD  SLC    V K W  +  DG  W ++     +TD     L
Sbjct: 16 ARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGL 72


>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.66
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 99.05
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.99
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.94
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.89
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.75
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.75
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.71
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.55
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.23
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.09
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.91
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.8
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.66
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 96.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.57
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.55
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 96.18
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 96.08
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 95.91
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 95.77
d2ifga3156 High affinity nerve growth factor receptor, N-term 95.47
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 95.36
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 95.21
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 94.79
d2ifga3156 High affinity nerve growth factor receptor, N-term 94.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 94.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 93.52
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 93.27
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 93.25
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 92.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 91.84
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 90.56
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 90.06
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.70  E-value=1.3e-16  Score=119.40  Aligned_cols=156  Identities=22%  Similarity=0.348  Sum_probs=121.2

Q ss_pred             CCCHHHHHHHHhcCCh---hhhHHHhhhhHHHHHhhhCCCCcceeeccCCCCCCCHHHHHHHHHHcCCCccEEeecCCCC
Q psy9585          29 KLPKELLLRIFSYLDV---TSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQS  105 (189)
Q Consensus        29 ~LP~~il~~I~~~L~~---~~~~~~~~v~~~w~~~~~~~~~~~~~~l~~~~~~~~~~~l~~l~~~~~~~L~~L~l~~~~~  105 (189)
                      .+.++.+..+++..+.   .++..+..-......+. ....++.++++++. .+++..+..+++.++. |++|++++|..
T Consensus        57 ~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~-~~~~L~~L~Ls~c~-~itd~~l~~l~~~~~~-L~~L~ls~c~~  133 (284)
T d2astb2          57 VIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLA-KNSNLVRLNLSGCS-GFSEFALQTLLSSCSR-LDELNLSWCFD  133 (284)
T ss_dssp             EECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHT-TCTTCSEEECTTCB-SCCHHHHHHHHHHCTT-CCEEECCCCTT
T ss_pred             ccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHh-cCCCCcCccccccc-cccccccchhhHHHHh-ccccccccccc
Confidence            3567888888887643   22334422222334443 33568899987654 7888899999999886 99999999988


Q ss_pred             CCHHHHHHH-HHcCCCcceEecccC-CCCCHHHHHHHHHcCCCCCEEecCCCCCCCHHHHHHHHhcCCCCCeeecccCcC
Q psy9585         106 MTDNSLNIL-AQYCNNVEDINLNLC-KKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCIN  183 (189)
Q Consensus       106 ~~~~~l~~l-~~~~~~L~~L~l~~~-~~i~~~~~~~l~~~~~~L~~L~L~~c~~i~~~~l~~l~~~~~~L~~L~l~~c~~  183 (189)
                      +++.++... ...+++|+.|++++| ..+++.++..+...||+|++|+|++|..+++.++..+.. ||+|++|++++|..
T Consensus       134 ~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~-~~~L~~L~L~~C~~  212 (284)
T d2astb2         134 FTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-LNYLQHLSLSRCYD  212 (284)
T ss_dssp             CCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGG-CTTCCEEECTTCTT
T ss_pred             cccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcc-cCcCCEEECCCCCC
Confidence            998887654 445689999999986 468899999998889999999999999999988888875 89999999999988


Q ss_pred             cCCCC
Q psy9585         184 ITENG  188 (189)
Q Consensus       184 lt~~~  188 (189)
                      ++++|
T Consensus       213 i~~~~  217 (284)
T d2astb2         213 IIPET  217 (284)
T ss_dssp             CCGGG
T ss_pred             CChHH
Confidence            88764



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure