Psyllid ID: psy9585
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 189 | ||||||
| 270006862 | 861 | hypothetical protein TcasGA2_TC013252 [T | 0.915 | 0.200 | 0.775 | 1e-75 | |
| 189237655 | 433 | PREDICTED: similar to AGAP007807-PA [Tri | 0.915 | 0.399 | 0.775 | 1e-74 | |
| 328696965 | 455 | PREDICTED: f-box/LRR-repeat protein 20-l | 0.915 | 0.380 | 0.729 | 9e-70 | |
| 307180560 | 458 | F-box/LRR-repeat protein 20 [Camponotus | 0.904 | 0.373 | 0.735 | 4e-69 | |
| 345491289 | 435 | PREDICTED: F-box/LRR-repeat protein 20-l | 0.968 | 0.420 | 0.706 | 4e-69 | |
| 332025721 | 427 | F-box/LRR-repeat protein 20 [Acromyrmex | 0.904 | 0.400 | 0.735 | 8e-69 | |
| 383857505 | 516 | PREDICTED: F-box/LRR-repeat protein 20-l | 0.899 | 0.329 | 0.735 | 1e-68 | |
| 345491287 | 515 | PREDICTED: F-box/LRR-repeat protein 20-l | 0.904 | 0.332 | 0.735 | 2e-68 | |
| 340723816 | 435 | PREDICTED: f-box/LRR-repeat protein 20-l | 0.968 | 0.420 | 0.690 | 1e-67 | |
| 350424926 | 513 | PREDICTED: F-box/LRR-repeat protein 20-l | 0.915 | 0.337 | 0.718 | 4e-67 |
| >gi|270006862|gb|EFA03310.1| hypothetical protein TcasGA2_TC013252 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 287 bits (735), Expect = 1e-75, Method: Compositional matrix adjust.
Identities = 135/174 (77%), Positives = 152/174 (87%)
Query: 15 LTRVFLEDEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFN 74
LT+V +DEALINKKLPKELLLRIFSY+DV SLCRCAQVSKAWN+LALDGSNW RIDLF+
Sbjct: 438 LTKVLSDDEALINKKLPKELLLRIFSYIDVVSLCRCAQVSKAWNVLALDGSNWQRIDLFD 497
Query: 75 FQTDVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTD 134
FQ DVEGP++ENISRRCGGFLRQ+SLRGCQS+ D S+ LAQ C NVED+NLN CKKLTD
Sbjct: 498 FQKDVEGPIIENISRRCGGFLRQLSLRGCQSIADGSMKTLAQLCPNVEDLNLNGCKKLTD 557
Query: 135 ATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENG 188
A+ A SKHC+KLQ+L+L CS ITD SLKAL+DGC NLTHINISW N+TENG
Sbjct: 558 ASCTAFSKHCSKLQKLNLDGCSAITDNSLKALSDGCPNLTHINISWSNNVTENG 611
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189237655|ref|XP_001812041.1| PREDICTED: similar to AGAP007807-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328696965|ref|XP_001945889.2| PREDICTED: f-box/LRR-repeat protein 20-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307180560|gb|EFN68516.1| F-box/LRR-repeat protein 20 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345491289|ref|XP_001603165.2| PREDICTED: F-box/LRR-repeat protein 20-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332025721|gb|EGI65879.1| F-box/LRR-repeat protein 20 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383857505|ref|XP_003704245.1| PREDICTED: F-box/LRR-repeat protein 20-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345491287|ref|XP_003426564.1| PREDICTED: F-box/LRR-repeat protein 20-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|340723816|ref|XP_003400284.1| PREDICTED: f-box/LRR-repeat protein 20-like isoform 1 [Bombus terrestris] gi|350424929|ref|XP_003493958.1| PREDICTED: F-box/LRR-repeat protein 20-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|350424926|ref|XP_003493957.1| PREDICTED: F-box/LRR-repeat protein 20-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 189 | ||||||
| UNIPROTKB|F1NHD2 | 423 | FBXL2 "Uncharacterized protein | 0.883 | 0.394 | 0.688 | 6.9e-63 | |
| UNIPROTKB|F1PWK1 | 422 | FBXL2 "Uncharacterized protein | 0.883 | 0.395 | 0.676 | 1.6e-61 | |
| UNIPROTKB|Q9UKC9 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.883 | 0.394 | 0.676 | 1.6e-61 | |
| UNIPROTKB|A6H779 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.883 | 0.394 | 0.670 | 5.5e-61 | |
| UNIPROTKB|Q5R3Z8 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.883 | 0.394 | 0.670 | 7.1e-61 | |
| MGI|MGI:1919429 | 423 | Fbxl2 "F-box and leucine-rich | 0.883 | 0.394 | 0.658 | 7.1e-61 | |
| RGD|1562243 | 422 | Fbxl2 "F-box and leucine-rich | 0.883 | 0.395 | 0.658 | 7.1e-61 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.883 | 0.383 | 0.676 | 3.9e-60 | |
| UNIPROTKB|Q96IG2 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.883 | 0.383 | 0.676 | 3.9e-60 | |
| MGI|MGI:1919444 | 436 | Fbxl20 "F-box and leucine-rich | 0.883 | 0.383 | 0.670 | 1.3e-59 |
| UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 642 (231.1 bits), Expect = 6.9e-63, P = 6.9e-63
Identities = 115/167 (68%), Positives = 141/167 (84%)
Query: 22 DEALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEG 81
DEALINKKLPKELLLRIFS+LD+ +LCRCAQVSKAWN+LALDGSNW +IDLFNFQTD+EG
Sbjct: 7 DEALINKKLPKELLLRIFSFLDIVTLCRCAQVSKAWNVLALDGSNWQKIDLFNFQTDIEG 66
Query: 82 PVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALS 141
V+ENIS+RCGGFLRQ+SLRGC + D+SL AQ C N+E +NLN C K+TD+T +LS
Sbjct: 67 RVVENISKRCGGFLRQLSLRGCHVVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS 126
Query: 142 KHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENG 188
+ C+KL+ LDL SC IT+ SLK L++GCRNL H+N+SWC IT++G
Sbjct: 127 RFCSKLKHLDLTSCVAITNSSLKGLSEGCRNLEHLNLSWCDQITKDG 173
|
|
| UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 189 | |||
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 7e-14 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 6e-11 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 4e-10 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 3e-07 | |
| smart00256 | 41 | smart00256, FBOX, A Receptor for Ubiquitination Ta | 2e-06 | |
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 9e-06 | |
| smart00367 | 26 | smart00367, LRR_CC, Leucine-rich repeat - CC (cyst | 6e-04 |
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
Score = 62.5 bits (153), Expect = 7e-14
Identities = 23/44 (52%), Positives = 27/44 (61%)
Query: 29 KLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDL 72
LP E+LL+IFSYLD L R A V + W LA D S W R+ L
Sbjct: 3 DLPDEILLQIFSYLDPRDLLRLALVCRRWRELASDDSLWRRLCL 46
|
This is an F-box-like family. Length = 47 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
| >gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 189 | |||
| KOG4341|consensus | 483 | 99.94 | ||
| KOG2120|consensus | 419 | 99.89 | ||
| KOG4341|consensus | 483 | 99.52 | ||
| KOG2120|consensus | 419 | 99.39 | ||
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.32 | |
| KOG1947|consensus | 482 | 99.28 | ||
| KOG1947|consensus | 482 | 99.2 | ||
| KOG3864|consensus | 221 | 98.88 | ||
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.8 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.78 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.75 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.55 | |
| KOG3864|consensus | 221 | 98.35 | ||
| KOG1909|consensus | 382 | 98.13 | ||
| KOG3665|consensus | 699 | 98.1 | ||
| KOG3207|consensus | 505 | 98.03 | ||
| KOG1909|consensus | 382 | 97.95 | ||
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.95 | |
| KOG3665|consensus | 699 | 97.67 | ||
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.65 | |
| KOG2997|consensus | 366 | 97.42 | ||
| KOG0281|consensus | 499 | 97.41 | ||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.1 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.08 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.08 | |
| KOG3207|consensus | 505 | 97.06 | ||
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.81 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.8 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.72 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 96.69 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.69 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.49 | |
| KOG2739|consensus | 260 | 96.4 | ||
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.4 | |
| KOG0618|consensus | 1081 | 96.35 | ||
| KOG2123|consensus | 388 | 96.32 | ||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.05 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.05 | |
| KOG2982|consensus | 418 | 95.81 | ||
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.79 | |
| KOG2739|consensus | 260 | 95.64 | ||
| KOG2982|consensus | 418 | 95.58 | ||
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.54 | |
| KOG2123|consensus | 388 | 94.67 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.57 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 94.52 | |
| KOG4194|consensus | 873 | 94.32 | ||
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 94.3 | |
| KOG3763|consensus | 585 | 94.17 | ||
| KOG4194|consensus | 873 | 94.16 | ||
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 93.94 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 93.53 | |
| KOG1859|consensus | 1096 | 93.52 | ||
| KOG0472|consensus | 565 | 93.48 | ||
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.13 | |
| KOG1644|consensus | 233 | 91.52 | ||
| KOG0444|consensus | 1255 | 91.22 | ||
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 91.16 | |
| KOG0444|consensus | 1255 | 91.04 | ||
| KOG0274|consensus | 537 | 90.98 | ||
| PF09372 | 97 | PRANC: PRANC domain; InterPro: IPR018272 This pres | 90.91 | |
| KOG1644|consensus | 233 | 87.7 | ||
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 86.43 | |
| KOG1259|consensus | 490 | 85.19 | ||
| KOG0618|consensus | 1081 | 84.97 | ||
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 84.91 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 84.67 | |
| KOG3926|consensus | 332 | 84.45 | ||
| KOG4237|consensus | 498 | 83.27 | ||
| KOG1259|consensus | 490 | 83.24 | ||
| KOG4658|consensus | 889 | 82.57 | ||
| KOG4308|consensus | 478 | 82.34 | ||
| KOG4579|consensus | 177 | 81.23 | ||
| KOG3735|consensus | 353 | 80.84 | ||
| KOG4658|consensus | 889 | 80.04 |
| >KOG4341|consensus | Back alignment and domain information |
|---|
Probab=99.94 E-value=8.4e-28 Score=184.87 Aligned_cols=164 Identities=55% Similarity=1.006 Sum_probs=157.9
Q ss_pred hhcCCCCHHHHHHHHhcCChhhhHHHhhhhHHHHHhhhCCCCcceeeccCCCCCCCHHHHHHHHHHcCCCccEEeecCCC
Q psy9585 25 LINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQ 104 (189)
Q Consensus 25 ~~~~~LP~~il~~I~~~L~~~~~~~~~~v~~~w~~~~~~~~~~~~~~l~~~~~~~~~~~l~~l~~~~~~~L~~L~l~~~~ 104 (189)
..--.||.|++.+||++|+.+.+.+++++|+.|...+.|...|.++|+..+..+++..++..+.++|+..|++|.++||.
T Consensus 70 ~~~~~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG~r 149 (483)
T KOG4341|consen 70 SISRSLPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRGCR 149 (483)
T ss_pred cccccCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhccccccccccccc
Confidence 33457999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCHHHHHHHHHcCCCcceEecccCCCCCHHHHHHHHHcCCCCCEEecCCCCCCCHHHHHHHHhcCCCCCeeecccCcCc
Q psy9585 105 SMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINI 184 (189)
Q Consensus 105 ~~~~~~l~~l~~~~~~L~~L~l~~~~~i~~~~~~~l~~~~~~L~~L~L~~c~~i~~~~l~~l~~~~~~L~~L~l~~c~~l 184 (189)
.+.+..+..+...||+++.|.+.+|.++|+..+..+.+.|++|++|+|..|..+|+..++.++++||+|++|+++||+.+
T Consensus 150 ~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi 229 (483)
T KOG4341|consen 150 AVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQI 229 (483)
T ss_pred cCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCC
Q psy9585 185 TENG 188 (189)
Q Consensus 185 t~~~ 188 (189)
+++|
T Consensus 230 ~~~g 233 (483)
T KOG4341|consen 230 SGNG 233 (483)
T ss_pred hcCc
Confidence 8865
|
|
| >KOG2120|consensus | Back alignment and domain information |
|---|
| >KOG4341|consensus | Back alignment and domain information |
|---|
| >KOG2120|consensus | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG1947|consensus | Back alignment and domain information |
|---|
| >KOG1947|consensus | Back alignment and domain information |
|---|
| >KOG3864|consensus | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3864|consensus | Back alignment and domain information |
|---|
| >KOG1909|consensus | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >KOG3207|consensus | Back alignment and domain information |
|---|
| >KOG1909|consensus | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2997|consensus | Back alignment and domain information |
|---|
| >KOG0281|consensus | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG3207|consensus | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG3763|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG1859|consensus | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG3926|consensus | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >KOG4658|consensus | Back alignment and domain information |
|---|
| >KOG4308|consensus | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >KOG3735|consensus | Back alignment and domain information |
|---|
| >KOG4658|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 189 | ||||
| 1fqv_A | 336 | Insights Into Scf Ubiquitin Ligases From The Struct | 2e-11 | ||
| 1fs2_A | 272 | Insights Into Scf Ubiquitin Ligases From The Struct | 2e-10 |
| >pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336 | Back alignment and structure |
|
| >pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 189 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-34 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-19 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-16 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 5e-12 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-28 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-17 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 9e-16 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-14 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-11 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-24 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-14 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-14 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-12 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-12 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-09 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-07 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 2e-20 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 5e-16 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 3e-12 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 4e-11 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 5e-11 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 7e-10 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 3e-09 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 8e-09 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 8e-09 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 9e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 5e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 7e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 123 bits (309), Expect = 2e-34
Identities = 54/178 (30%), Positives = 84/178 (47%), Gaps = 19/178 (10%)
Query: 28 KKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLF--NFQTDVEGPVLE 85
LP ELLL IFS L + L + + V K W LA D S W +DL N DV G +L
Sbjct: 10 DSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLS 69
Query: 86 N--ISRRCGGFLRQISLRGCQS-------------MTDNSLNILAQYCNNVEDINLNLCK 130
I+ RC L S + ++L+ + C+ +++++L +
Sbjct: 70 QGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLR 129
Query: 131 KLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCINITENG 188
L+D L+K+ L RL+L+ CS ++ +L+ L C L +N+SWC + TE
Sbjct: 130 -LSDPIVNTLAKNS-NLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKH 185
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 189 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.89 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.83 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.75 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.73 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.55 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.38 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.35 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.27 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.15 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.1 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.99 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.95 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.91 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.82 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.8 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.78 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.66 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.61 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.58 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.58 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.56 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.48 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.47 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.38 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.28 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.18 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 98.14 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.14 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.02 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.0 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.94 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.82 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.73 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.72 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.71 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.6 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.51 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.48 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.37 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.17 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.12 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.08 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.0 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.0 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 96.99 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 96.97 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 96.94 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 96.94 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.94 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 96.94 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 96.91 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 96.91 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 96.9 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.9 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 96.9 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 96.89 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 96.85 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 96.84 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.78 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 96.78 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.78 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.76 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 96.76 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 96.75 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.71 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.7 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 96.69 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 96.65 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 96.65 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 96.65 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.64 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.64 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 96.62 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 96.61 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.61 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.61 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.61 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.61 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 96.59 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 96.58 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.57 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 96.56 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 96.55 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 96.54 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 96.53 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 96.51 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.51 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 96.48 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.48 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 96.46 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.44 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 96.44 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.42 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 96.41 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.41 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 96.4 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 96.4 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 96.34 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.34 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.33 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.32 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 96.31 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 96.31 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.3 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.27 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 96.27 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 96.26 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.26 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 96.26 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.25 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 96.24 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.24 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 96.24 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.23 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.23 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 96.22 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 96.2 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.16 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 96.14 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 96.14 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 96.08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 96.05 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 96.04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.03 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 95.96 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.94 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.94 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 95.94 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 95.93 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 95.92 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 95.91 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 95.88 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 95.86 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.85 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 95.85 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 95.84 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 95.76 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 95.58 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 95.54 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 95.39 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 95.36 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 94.86 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.79 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 94.72 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.61 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 94.47 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 94.26 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 94.14 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 93.37 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 92.22 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 91.84 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 91.69 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 91.41 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 90.92 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 90.36 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 89.5 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.89 E-value=4.9e-22 Score=153.90 Aligned_cols=156 Identities=30% Similarity=0.472 Sum_probs=99.8
Q ss_pred hhhcCCCCHHHHHHHHhcCChhhhHHHhhhhHHHHHhhhCCCCcceeeccCCCC--------------------------
Q psy9585 24 ALINKKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQT-------------------------- 77 (189)
Q Consensus 24 ~~~~~~LP~~il~~I~~~L~~~~~~~~~~v~~~w~~~~~~~~~~~~~~l~~~~~-------------------------- 77 (189)
...|++||+|++.+||+||+..|+.+++.||++|++++.++..|+.++++....
T Consensus 6 ~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~~~ 85 (336)
T 2ast_B 6 GVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQP 85 (336)
T ss_dssp -CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEECSC
T ss_pred cCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCCHHHHHhhhhccceEEEcCCcccccc
Confidence 456999999999999999999999999999999999998888899988764310
Q ss_pred ------------------CCCHHHHHHHHHHcCCCccEEeecCCCCCCHHHHHHHHHcCCCcceEecccCCCCCHHHHHH
Q psy9585 78 ------------------DVEGPVLENISRRCGGFLRQISLRGCQSMTDNSLNILAQYCNNVEDINLNLCKKLTDATSLA 139 (189)
Q Consensus 78 ------------------~~~~~~l~~l~~~~~~~L~~L~l~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~i~~~~~~~ 139 (189)
.+++..+..+...+++ |++|+++++ .+++.....+. .+++|++|++++|..+++.++..
T Consensus 86 ~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~-L~~L~L~~~-~l~~~~~~~l~-~~~~L~~L~L~~~~~l~~~~l~~ 162 (336)
T 2ast_B 86 LAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSK-LQNLSLEGL-RLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQT 162 (336)
T ss_dssp CCSCCCCBCCCEEECTTCEECHHHHHHHHTTBCC-CSEEECTTC-BCCHHHHHHHT-TCTTCSEEECTTCBSCCHHHHHH
T ss_pred chhhccCCCCCEEEccCCCcCHHHHHHHHhhCCC-CCEEeCcCc-ccCHHHHHHHh-cCCCCCEEECCCCCCCCHHHHHH
Confidence 1122334444445543 666666654 34444444333 35566666666554555555555
Q ss_pred HHHcCCCCCEEecCCCCCCCHHHHHHHHhcCC-CCCeeecccCc
Q psy9585 140 LSKHCAKLQRLDLASCSFITDQSLKALADGCR-NLTHINISWCI 182 (189)
Q Consensus 140 l~~~~~~L~~L~L~~c~~i~~~~l~~l~~~~~-~L~~L~l~~c~ 182 (189)
+...+++|++|+|++|..+++.++..+...+| +|++|++++|.
T Consensus 163 ~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~ 206 (336)
T 2ast_B 163 LLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYR 206 (336)
T ss_dssp HHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCG
T ss_pred HHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCc
Confidence 55555566666666553455555444444455 55555555553
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 189 | ||||
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 4e-12 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 4e-12 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 5e-10 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 1e-08 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 |
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: F-box/WD-repeat protein 1 (beta-TRCP1) species: Human (Homo sapiens) [TaxId: 9606]
Score = 58.2 bits (140), Expect = 4e-12
Identities = 17/57 (29%), Positives = 23/57 (40%)
Query: 28 KKLPKELLLRIFSYLDVTSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVL 84
+ + I SYLD SLC V K W + DG W ++ +TD L
Sbjct: 16 ARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGL 72
|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 189 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.7 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.66 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 99.05 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.99 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.99 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.94 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.92 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.89 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.8 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.75 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.75 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.71 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.51 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.55 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.54 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.23 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.09 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 96.91 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 96.8 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.78 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.71 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.66 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.62 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.57 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.55 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.55 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.36 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 96.18 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.08 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.91 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.77 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.47 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 95.36 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 95.21 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 94.79 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 94.74 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 94.67 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 93.52 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 93.27 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 93.25 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 92.94 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 91.84 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 90.56 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 90.06 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.70 E-value=1.3e-16 Score=119.40 Aligned_cols=156 Identities=22% Similarity=0.348 Sum_probs=121.2
Q ss_pred CCCHHHHHHHHhcCCh---hhhHHHhhhhHHHHHhhhCCCCcceeeccCCCCCCCHHHHHHHHHHcCCCccEEeecCCCC
Q psy9585 29 KLPKELLLRIFSYLDV---TSLCRCAQVSKAWNILALDGSNWSRIDLFNFQTDVEGPVLENISRRCGGFLRQISLRGCQS 105 (189)
Q Consensus 29 ~LP~~il~~I~~~L~~---~~~~~~~~v~~~w~~~~~~~~~~~~~~l~~~~~~~~~~~l~~l~~~~~~~L~~L~l~~~~~ 105 (189)
.+.++.+..+++..+. .++..+..-......+. ....++.++++++. .+++..+..+++.++. |++|++++|..
T Consensus 57 ~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~-~~~~L~~L~Ls~c~-~itd~~l~~l~~~~~~-L~~L~ls~c~~ 133 (284)
T d2astb2 57 VIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLA-KNSNLVRLNLSGCS-GFSEFALQTLLSSCSR-LDELNLSWCFD 133 (284)
T ss_dssp EECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHT-TCTTCSEEECTTCB-SCCHHHHHHHHHHCTT-CCEEECCCCTT
T ss_pred ccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHh-cCCCCcCccccccc-cccccccchhhHHHHh-ccccccccccc
Confidence 3567888888887643 22334422222334443 33568899987654 7888899999999886 99999999988
Q ss_pred CCHHHHHHH-HHcCCCcceEecccC-CCCCHHHHHHHHHcCCCCCEEecCCCCCCCHHHHHHHHhcCCCCCeeecccCcC
Q psy9585 106 MTDNSLNIL-AQYCNNVEDINLNLC-KKLTDATSLALSKHCAKLQRLDLASCSFITDQSLKALADGCRNLTHINISWCIN 183 (189)
Q Consensus 106 ~~~~~l~~l-~~~~~~L~~L~l~~~-~~i~~~~~~~l~~~~~~L~~L~L~~c~~i~~~~l~~l~~~~~~L~~L~l~~c~~ 183 (189)
+++.++... ...+++|+.|++++| ..+++.++..+...||+|++|+|++|..+++.++..+.. ||+|++|++++|..
T Consensus 134 ~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~-~~~L~~L~L~~C~~ 212 (284)
T d2astb2 134 FTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-LNYLQHLSLSRCYD 212 (284)
T ss_dssp CCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGG-CTTCCEEECTTCTT
T ss_pred cccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcc-cCcCCEEECCCCCC
Confidence 998887654 445689999999986 468899999998889999999999999999988888875 89999999999988
Q ss_pred cCCCC
Q psy9585 184 ITENG 188 (189)
Q Consensus 184 lt~~~ 188 (189)
++++|
T Consensus 213 i~~~~ 217 (284)
T d2astb2 213 IIPET 217 (284)
T ss_dssp CCGGG
T ss_pred CChHH
Confidence 88764
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|