Diaphorina citri psyllid: psy9586


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
VSGSFTVKDIKKEVHKAKSQLYPDRQAVRLEIKGKILKDSDDIKSLGLKNGDMVFIKDLGPQIGWSTVFMAEYAGPLFVYLIFYYRPWIFYGSEAASKPYSYVAHLAALCYIVHYTKRVLETLTPSVFCQLGNLSIHLALRDLRPPGTNVRRIPVATSNPFTSLFDYVSCPNYTYEFGSWLSFSLLTSCFPALLFASAGMYQMTVWALGKHKNYKKEFPDYPKQRKAIVPFVI
ccccccHHHHHHHHHHHccccccccEEEEEccccccccccccHHccccccccEEEEECcccccccccEEEEEEcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEECccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccc
**GSFTVKDIKKEVHKAKSQLYPDRQAVRLEIKGKILKDSDDIKSLGLKNGDMVFIKDLGPQIGWSTVFMAEYAGPLFVYLIFYYRPWIFYGSEAASKPYSYVAHLAALCYIVHYTKRVLETLTPSVFCQLGNLSIHLALRDLRPPGTNVRRIPVATSNPFTSLFDYVSCPNYTYEFGSWLSFSLLTSCFPALLFASAGMYQMTVWALGKHKNYKKEFPDYPKQRKAIVPFVI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VSGSFTVKDIKKEVHKAKSQLYPDRQAVRLEIKGKILKDSDDIKSLGLKNGDMVFIKDLGPQIGWSTVFMAEYAGPLFVYLIFYYRPWIFYGSEAASKPYSYVAHLAALCYIVHYTKRVLETLTPSVFCQLGNLSIHLALRDLRPPGTNVRRIPVATSNPFTSLFDYVSCPNYTYEFGSWLSFSLLTSCFPALLFASAGMYQMTVWALGKHKNYKKEFPDYPKQRKAIVPFVI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Very-long-chain enoyl-CoA reductase Reduces trans-2,3-stearoyl-CoA to stearoyl-CoA of long and very long chain fatty acids.confidentQ55C17
Putative enoyl reductase C646.07c confidentO94511
Probable very-long-chain enoyl-CoA reductase art-1 Reduces trans-2,3-acyl-CoA to acyl-CoA of long and very long chain fatty acids.confidentQ9N5Y2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016627 [MF]oxidoreductase activity, acting on the CH-CH group of donorsprobableGO:0003824, GO:0003674, GO:0016491
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0008202 [BP]steroid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DZJ, chain A
Confidence level:confident
Coverage over the Query: 1-59
View the alignment between query and template
View the model in PyMOL
Template: 4A2N, chain B
Confidence level:probable
Coverage over the Query: 127-231
View the alignment between query and template
View the model in PyMOL