Psyllid ID: psy9586
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 233 | ||||||
| 242004484 | 302 | synaptic glycoprotein SC2, putative [Ped | 0.995 | 0.768 | 0.542 | 2e-85 | |
| 239789843 | 299 | ACYPI001763 [Acyrthosiphon pisum] | 0.995 | 0.775 | 0.561 | 1e-83 | |
| 194866183 | 302 | GG15168 [Drosophila erecta] gi|190653580 | 0.991 | 0.764 | 0.512 | 2e-77 | |
| 27819746 | 306 | SD09294p, partial [Drosophila melanogast | 0.991 | 0.754 | 0.512 | 2e-77 | |
| 195337253 | 302 | GM14597 [Drosophila sechellia] gi|194128 | 0.991 | 0.764 | 0.515 | 4e-77 | |
| 211938631 | 306 | FI06688p [Drosophila melanogaster] | 0.991 | 0.754 | 0.512 | 5e-77 | |
| 24657023 | 302 | Sc2 [Drosophila melanogaster] gi|7292402 | 0.991 | 0.764 | 0.512 | 6e-77 | |
| 195491531 | 302 | GE21388 [Drosophila yakuba] gi|194179701 | 0.991 | 0.764 | 0.508 | 6e-77 | |
| 156543298 | 300 | PREDICTED: trans-2,3-enoyl-CoA reductase | 0.995 | 0.773 | 0.540 | 1e-76 | |
| 307191148 | 300 | Synaptic glycoprotein SC2 [Camponotus fl | 0.995 | 0.773 | 0.526 | 3e-76 |
| >gi|242004484|ref|XP_002423113.1| synaptic glycoprotein SC2, putative [Pediculus humanus corporis] gi|212506059|gb|EEB10375.1| synaptic glycoprotein SC2, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 321 bits (822), Expect = 2e-85, Method: Compositional matrix adjust.
Identities = 153/282 (54%), Positives = 193/282 (68%), Gaps = 50/282 (17%)
Query: 2 SGSFTVKDIKKEVHKAKSQLYPDRQAVRLEIKGKILKDSDDIKSLGLKNGDMVFIKDLGP 61
S S TV +KKEV+K +L+P+RQ+++L++KGK LKD+D +KSL L +G V++KDLGP
Sbjct: 21 SSSTTVAQLKKEVYKLNKKLHPNRQSLKLDVKGKALKDNDTLKSLNLMDGSKVYVKDLGP 80
Query: 62 QIGWSTVFMAEYAGPLFVYLIFYYRPWIFYGSEAASKPYSYVAHLAALCYIVHYTKRVLE 121
QIGW TVF+AEYAGPL VYL+FY RPW+ YG++ + PY +V H+AA CY HY KR+LE
Sbjct: 81 QIGWKTVFLAEYAGPLGVYLLFYQRPWLIYGNDVENLPYHFVVHIAAACYFFHYFKRILE 140
Query: 122 TL---------------------------------------TPS-----------VFCQL 131
TL PS + C+
Sbjct: 141 TLFVHRFSHATMPLTNLFKNCSYYWMFTAYVAYHINHPLYTAPSFLQIYLSLALFLLCEF 200
Query: 132 GNLSIHLALRDLRPPGTNVRRIPVATSNPFTSLFDYVSCPNYTYEFGSWLSFSLLTSCFP 191
GN SIH+ALR+LRP G+NVR+IPVAT NPFT LF++VSCPNYTYEFGSW+ F+L+T C P
Sbjct: 201 GNFSIHVALRNLRPAGSNVRKIPVATKNPFTKLFNFVSCPNYTYEFGSWVFFTLMTQCLP 260
Query: 192 ALLFASAGMYQMTVWALGKHKNYKKEFPDYPKQRKAIVPFVI 233
A +FA AGMYQMTVWA+GKHKNYKKEFP+YPK RKAI+PF+I
Sbjct: 261 AAIFALAGMYQMTVWAIGKHKNYKKEFPNYPKNRKAILPFLI 302
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|239789843|dbj|BAH71520.1| ACYPI001763 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|194866183|ref|XP_001971797.1| GG15168 [Drosophila erecta] gi|190653580|gb|EDV50823.1| GG15168 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|27819746|gb|AAL29169.2| SD09294p, partial [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195337253|ref|XP_002035243.1| GM14597 [Drosophila sechellia] gi|194128336|gb|EDW50379.1| GM14597 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|211938631|gb|ACJ13212.1| FI06688p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|24657023|ref|NP_647836.2| Sc2 [Drosophila melanogaster] gi|7292402|gb|AAF47807.1| Sc2 [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195491531|ref|XP_002093600.1| GE21388 [Drosophila yakuba] gi|194179701|gb|EDW93312.1| GE21388 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|156543298|ref|XP_001601952.1| PREDICTED: trans-2,3-enoyl-CoA reductase-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307191148|gb|EFN74846.1| Synaptic glycoprotein SC2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 233 | ||||||
| FB|FBgn0035471 | 306 | Sc2 "Sc2" [Drosophila melanoga | 0.450 | 0.343 | 0.704 | 5.2e-79 | |
| WB|WBGene00000198 | 308 | art-1 [Caenorhabditis elegans | 0.459 | 0.347 | 0.616 | 4.8e-64 | |
| RGD|1304608 | 361 | Tecrl "trans-2,3-enoyl-CoA red | 0.527 | 0.340 | 0.419 | 1.8e-46 | |
| UNIPROTKB|Q5HYJ1 | 363 | TECRL "Trans-2,3-enoyl-CoA red | 0.527 | 0.338 | 0.435 | 3.7e-46 | |
| UNIPROTKB|Q3SZ89 | 363 | TECRL "Trans-2,3-enoyl-CoA red | 0.527 | 0.338 | 0.419 | 4.7e-46 | |
| MGI|MGI:2444966 | 361 | Tecrl "trans-2,3-enoyl-CoA red | 0.527 | 0.340 | 0.403 | 4.7e-46 | |
| UNIPROTKB|F1NVP7 | 361 | TECRL "Uncharacterized protein | 0.515 | 0.332 | 0.429 | 1.2e-45 | |
| UNIPROTKB|J9P679 | 363 | TECRL "Uncharacterized protein | 0.506 | 0.325 | 0.403 | 9.6e-44 | |
| UNIPROTKB|I3LUN1 | 267 | TECRL "Uncharacterized protein | 0.497 | 0.434 | 0.393 | 1.1e-42 | |
| UNIPROTKB|E9PD39 | 326 | TECRL "Trans-2,3-enoyl-CoA red | 0.527 | 0.377 | 0.435 | 3.5e-38 |
| FB|FBgn0035471 Sc2 "Sc2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 432 (157.1 bits), Expect = 5.2e-79, Sum P(2) = 5.2e-79
Identities = 74/105 (70%), Positives = 89/105 (84%)
Query: 129 CQLGNLSIHLALRDLRPPGTNVRRIPVATSNPFTSLFDYVSCPNYTYEFGSWLSFSLLTS 188
C+LGN S+H+ALR+LRPPGT VR+IPVA NP T LFD VSCPNYTYE G+W+SFS+LTS
Sbjct: 202 CELGNFSVHIALRNLRPPGTKVRKIPVADGNPLTKLFDLVSCPNYTYEIGAWVSFSVLTS 261
Query: 189 CFPALLFASAGMYQMTVWALGKHKNYKKEFPDYPKQRKAIVPFVI 233
C A LFA AG +QMT+WAL KH+NYKKEF DYP+QR++I PFV+
Sbjct: 262 CLAAYLFAFAGAFQMTIWALAKHRNYKKEFKDYPRQRRSIFPFVL 306
|
|
| WB|WBGene00000198 art-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| RGD|1304608 Tecrl "trans-2,3-enoyl-CoA reductase-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5HYJ1 TECRL "Trans-2,3-enoyl-CoA reductase-like" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SZ89 TECRL "Trans-2,3-enoyl-CoA reductase-like" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2444966 Tecrl "trans-2,3-enoyl-CoA reductase-like" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NVP7 TECRL "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P679 TECRL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LUN1 TECRL "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PD39 TECRL "Trans-2,3-enoyl-CoA reductase-like" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 233 | |||
| PLN02560 | 308 | PLN02560, PLN02560, enoyl-CoA reductase | 2e-50 | |
| pfam02544 | 150 | pfam02544, Steroid_dh, 3-oxo-5-alpha-steroid 4-deh | 2e-26 | |
| cd01801 | 77 | cd01801, Tsc13_N, Ubiquitin-like domain of Tsc13 | 7e-16 | |
| PLN02392 | 260 | PLN02392, PLN02392, probable steroid reductase DET | 7e-08 | |
| PLN03164 | 323 | PLN03164, PLN03164, 3-oxo-5-alpha-steroid 4-dehydr | 2e-06 | |
| cd01769 | 69 | cd01769, UBL, Ubiquitin-like domain of UBL | 3e-06 | |
| cd01805 | 77 | cd01805, RAD23_N, Ubiquitin-like domain of RAD23 | 9e-04 | |
| cd00196 | 69 | cd00196, UBQ, Ubiquitin-like proteins | 0.002 | |
| cd01812 | 71 | cd01812, BAG1_N, Ubiquitin-like domain of BAG1 | 0.003 |
| >gnl|CDD|178174 PLN02560, PLN02560, enoyl-CoA reductase | Back alignment and domain information |
|---|
Score = 166 bits (421), Expect = 2e-50
Identities = 96/295 (32%), Positives = 130/295 (44%), Gaps = 69/295 (23%)
Query: 1 VSGSFTVKDIKKEVHKAKSQLYPDRQAVRL-----EIKGKILKDSDDIKSLGLKNGDMVF 55
V S TV D+KK +HK K + YP RQ + L + + +L DS +K GL +G V
Sbjct: 20 VPDSATVADLKKAIHKRKKKYYPSRQRLTLPLPPGKTRPTVLDDSKSLKDYGLGDGGTVV 79
Query: 56 IKDLGPQIGWSTVFMAEYAGPLFVYLIFYYRPWIF-YGSEAASKPYSYVAHLAALCYIVH 114
KDLGPQ+ + T+F EY GPL +Y +FY+ P ++ Y A + V A + H
Sbjct: 80 FKDLGPQVSYRTLFFFEYLGPLLIYPLFYFFPQVYKYFGYPARRVIHPVQTYAMYYWCFH 139
Query: 115 YTKRVLETL--------------------------------------TP----------- 125
Y KR+LET TP
Sbjct: 140 YAKRILETFFVHRFSHATSPLFNVFRNCAYYWTFGAYIAYFVNHPLYTPVSETQMKVGFG 199
Query: 126 -SVFCQLGNLSIHLALRDLRPP-GTNVRRIPVATSNPFTSLFDYVSCPNYTYEFGSWLSF 183
+ CQL N H+ LR+LR P G +IP LF+YV+C NYT E WL F
Sbjct: 200 FGLVCQLANFYCHIILRNLRKPDGKGGYQIPRG------FLFNYVTCANYTTEIYQWLGF 253
Query: 184 SLLTSCFPALLFASAGMYQMTVWALGKHKNYKKEF------PDYPKQRKAIVPFV 232
++ T LF + MT WAL KH+ KK F P YP++ + PF+
Sbjct: 254 NIATQTVAGYLFLAVAAAIMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 308
|
Length = 308 |
| >gnl|CDD|217095 pfam02544, Steroid_dh, 3-oxo-5-alpha-steroid 4-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176396 cd01801, Tsc13_N, Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >gnl|CDD|178015 PLN02392, PLN02392, probable steroid reductase DET2 | Back alignment and domain information |
|---|
| >gnl|CDD|215610 PLN03164, PLN03164, 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal domain containing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >gnl|CDD|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 233 | |||
| PLN02560 | 308 | enoyl-CoA reductase | 100.0 | |
| KOG1639|consensus | 297 | 100.0 | ||
| KOG1638|consensus | 257 | 100.0 | ||
| PLN02392 | 260 | probable steroid reductase DET2 | 100.0 | |
| PLN03164 | 323 | 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal | 100.0 | |
| PF02544 | 150 | Steroid_dh: 3-oxo-5-alpha-steroid 4-dehydrogenase | 100.0 | |
| KOG1640|consensus | 304 | 99.97 | ||
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 99.55 | |
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 99.5 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 99.47 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 99.45 | |
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 99.44 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 99.41 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 99.41 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 99.4 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 99.4 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 99.39 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 99.39 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 99.38 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 99.35 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 99.33 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 99.32 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 99.31 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 99.31 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 99.31 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 99.3 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 99.3 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 99.29 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 99.29 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 99.29 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 99.22 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 99.22 | |
| KOG0005|consensus | 70 | 99.18 | ||
| KOG0004|consensus | 156 | 99.16 | ||
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 99.1 | |
| KOG0003|consensus | 128 | 99.09 | ||
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 99.09 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 99.07 | |
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 98.97 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 98.96 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 98.95 | |
| KOG0010|consensus | 493 | 98.9 | ||
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 98.85 | |
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 98.84 | |
| PF06966 | 235 | DUF1295: Protein of unknown function (DUF1295); In | 98.7 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 98.38 | |
| COG3752 | 272 | Steroid 5-alpha reductase family enzyme [General f | 98.23 | |
| KOG0011|consensus | 340 | 98.22 | ||
| cd01788 | 119 | ElonginB Ubiquitin-like domain of Elongin B. Elong | 98.21 | |
| KOG0001|consensus | 75 | 98.18 | ||
| KOG4248|consensus | 1143 | 98.07 | ||
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 98.01 | |
| PF04191 | 106 | PEMT: Phospholipid methyltransferase ; InterPro: I | 97.86 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 97.84 | |
| PF01222 | 432 | ERG4_ERG24: Ergosterol biosynthesis ERG4/ERG24 fam | 97.75 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 97.59 | |
| KOG4495|consensus | 110 | 97.45 | ||
| COG2020 | 187 | STE14 Putative protein-S-isoprenylcysteine methylt | 97.33 | |
| cd01811 | 80 | OASL_repeat1 2'-5' oligoadenylate synthetase-like | 96.99 | |
| KOG1872|consensus | 473 | 96.88 | ||
| KOG3493|consensus | 73 | 96.44 | ||
| KOG0006|consensus | 446 | 96.35 | ||
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 96.22 | |
| KOG1435|consensus | 428 | 96.16 | ||
| KOG4650|consensus | 311 | 96.06 | ||
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 96.01 | |
| KOG3206|consensus | 234 | 95.16 | ||
| PF04140 | 94 | ICMT: Isoprenylcysteine carboxyl methyltransferase | 94.53 | |
| KOG0013|consensus | 231 | 94.52 | ||
| PF15044 | 76 | CLU_N: Mitochondrial function, CLU-N-term | 93.62 | |
| KOG1769|consensus | 99 | 93.43 | ||
| PF10209 | 122 | DUF2340: Uncharacterized conserved protein (DUF234 | 91.09 | |
| cd01774 | 85 | Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i | 90.23 | |
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 90.03 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 90.01 | |
| KOG2628|consensus | 201 | 88.5 | ||
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 88.34 | |
| cd01767 | 77 | UBX UBX (ubiquitin regulatory X) domain. The UBX ( | 86.19 | |
| PF13019 | 162 | Telomere_Sde2: Telomere stability and silencing | 84.83 | |
| TIGR01682 | 80 | moaD molybdopterin converting factor, subunit 1, n | 84.62 | |
| PF10407 | 73 | Cytokin_check_N: Cdc14 phosphatase binding protein | 83.99 | |
| cd01770 | 79 | p47_UBX p47-like ubiquitin domain. p47_UBX p47 is | 83.21 | |
| COG1755 | 172 | Uncharacterized protein conserved in bacteria [Fun | 82.89 | |
| PLN02799 | 82 | Molybdopterin synthase sulfur carrier subunit | 81.23 | |
| cd00754 | 80 | MoaD Ubiquitin domain of MoaD-like proteins. MoaD | 81.2 | |
| cd01772 | 79 | SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst | 81.16 |
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-74 Score=521.12 Aligned_cols=225 Identities=42% Similarity=0.766 Sum_probs=202.0
Q ss_pred CCCcccHHHHHHHHHHHhCCCCcCceeEEEc-----CCCcccCCchhhhhcCCCCCceEEEecCCCccchhhhhhHHhhh
Q psy9586 1 VSGSFTVKDIKKEVHKAKSQLYPDRQAVRLE-----IKGKILKDSDDIKSLGLKNGDMVFIKDLGPQIGWSTVFMAEYAG 75 (233)
Q Consensus 1 v~~~~TV~~LK~~i~~~~~~i~~~rQrL~~~-----~~Gk~L~d~ktL~~ygv~~~~tl~vkdlg~qi~w~~vf~~Ey~g 75 (233)
+++++||+|||++|+++...++++||||+++ ++|+.|+|+++|+|+|+++|+||++|||||||||||||++||+|
T Consensus 20 v~~~aTV~dLK~~Isk~~~~~~~~RqRL~~~~~~gk~~g~~L~d~ktL~d~gv~~gstLy~kDLGpQi~wrtVF~~EY~G 99 (308)
T PLN02560 20 VPDSATVADLKKAIHKRKKKYYPSRQRLTLPLPPGKTRPTVLDDSKSLKDYGLGDGGTVVFKDLGPQVSYRTLFFFEYLG 99 (308)
T ss_pred cCCCCcHHHHHHHHHHHcCCCChhheEEEEecCCCCcCccccCCCCCHHhcCCCCCceEEEEeCCCcCchhhhHHHHhhh
Confidence 4789999999999999933358999999985 24568999999999999999999999999999999999999999
Q ss_pred hHHHHHHHHhccccccCC-C-CCCCchhHHHHHHHHHHHHHHHHHHHhhh---------ch-------------------
Q psy9586 76 PLFVYLIFYYRPWIFYGS-E-AASKPYSYVAHLAALCYIVHYTKRVLETL---------TP------------------- 125 (233)
Q Consensus 76 pl~~~~~~~~~~~~i~~~-~-~~~~~~~~~~~l~~~~~~~Hy~kR~~et~---------~p------------------- 125 (233)
||+++++||++++ +|+. . ....+.+..|+++++||++||+||++||+ +|
T Consensus 100 Pl~i~~l~y~~~~-~y~~~~~~~~~~~~~~~~l~~~~~~~Hy~kR~~Et~fvhrfS~~tmpl~n~~~n~~~Yw~~~~~~~ 178 (308)
T PLN02560 100 PLLIYPLFYFFPQ-VYKYFGYPARRVIHPVQTYAMYYWCFHYAKRILETFFVHRFSHATSPLFNVFRNCAYYWTFGAYIA 178 (308)
T ss_pred HHHHHHHHHHhhh-hhcccccCcCCCCchHHHHHHHHHHHHHHHHhhheeeeEeecCCCccHHHHHHHHHHHHHHHHHHh
Confidence 9999999999888 9862 1 11245678899999999999999999998 11
Q ss_pred ----------------------hhhHhhhhHHHHHHHHhcCCC-CCcccccccCCCCCCCCccceecccchhhHHHHHHH
Q psy9586 126 ----------------------SVFCQLGNLSIHLALRDLRPP-GTNVRRIPVATSNPFTSLFDYVSCPNYTYEFGSWLS 182 (233)
Q Consensus 126 ----------------------~~~~~~~n~~~h~~L~~LR~~-~~~~~~ip~~~~~P~gglF~~VscPnY~~Eil~w~~ 182 (233)
.++||.+|++||.+|++||++ |+++|+||+ ||||++|||||||+||++|+|
T Consensus 179 y~~~~~~~~~~~~~~~~~g~~lf~~~~~~N~~~h~~L~~LR~~~g~~~y~IP~------g~lF~~VscPnY~~Ei~~W~g 252 (308)
T PLN02560 179 YFVNHPLYTPVSETQMKVGFGFGLVCQLANFYCHIILRNLRKPDGKGGYQIPR------GFLFNYVTCANYTTEIYQWLG 252 (308)
T ss_pred hhcccCCccccchhHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCeeCCC------CCCcCeecCCcHHHHHHHHHH
Confidence 178899999999999999998 998888887 899999999999999999999
Q ss_pred HHHhhcchhHHHHHHHHHHHHHHHHHHHhHHHHhhCCC------CCCCceeeeccc
Q psy9586 183 FSLLTSCFPALLFASAGMYQMTVWALGKHKNYKKEFPD------YPKQRKAIVPFV 232 (233)
Q Consensus 183 f~l~~~~~~~~~f~~~~~~~m~~~A~~~h~wY~~~F~~------yp~~RkaiIPfi 232 (233)
|+++++++++++|++++++||.+||.+|||||+++|+| ||++|++++||+
T Consensus 253 f~~~t~~~~~~~F~~~~~~~m~~wA~~kh~~Y~k~F~d~~~~~~yp~~~~~~pp~~ 308 (308)
T PLN02560 253 FNIATQTVAGYLFLAVAAAIMTNWALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 308 (308)
T ss_pred HHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCccccccCCCceEeCCCcC
Confidence 99999999999999999999999999999999999987 999777777764
|
|
| >KOG1639|consensus | Back alignment and domain information |
|---|
| >KOG1638|consensus | Back alignment and domain information |
|---|
| >PLN02392 probable steroid reductase DET2 | Back alignment and domain information |
|---|
| >PLN03164 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal domain containing protein; Provisional | Back alignment and domain information |
|---|
| >PF02544 Steroid_dh: 3-oxo-5-alpha-steroid 4-dehydrogenase ; InterPro: IPR001104 Synonym(s): Steroid 5-alpha-reductase 3-oxo-5-alpha-steroid 4-dehydrogenases, 1 | Back alignment and domain information |
|---|
| >KOG1640|consensus | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >KOG0005|consensus | Back alignment and domain information |
|---|
| >KOG0004|consensus | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >KOG0003|consensus | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >KOG0010|consensus | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
| >PF06966 DUF1295: Protein of unknown function (DUF1295); InterPro: IPR010721 This family contains a number of bacterial and eukaryotic proteins of unknown function that are approximately 300 residues long | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >COG3752 Steroid 5-alpha reductase family enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0011|consensus | Back alignment and domain information |
|---|
| >cd01788 ElonginB Ubiquitin-like domain of Elongin B | Back alignment and domain information |
|---|
| >KOG0001|consensus | Back alignment and domain information |
|---|
| >KOG4248|consensus | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PF04191 PEMT: Phospholipid methyltransferase ; InterPro: IPR007318 The Saccharomyces cerevisiae (Baker's yeast) phospholipid methyltransferase (2 | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >PF01222 ERG4_ERG24: Ergosterol biosynthesis ERG4/ERG24 family; InterPro: IPR001171 The two fungal enzymes, C-14 sterol reductase (gene ERG24 in budding yeast and erg3 in Neurospora crassa) and C-24(28) sterol reductase (gene ERG4 in budding yeast and sts1 in fission yeast), are involved in ergosterol biosynthesis | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >KOG4495|consensus | Back alignment and domain information |
|---|
| >COG2020 STE14 Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 | Back alignment and domain information |
|---|
| >KOG1872|consensus | Back alignment and domain information |
|---|
| >KOG3493|consensus | Back alignment and domain information |
|---|
| >KOG0006|consensus | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >KOG1435|consensus | Back alignment and domain information |
|---|
| >KOG4650|consensus | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >KOG3206|consensus | Back alignment and domain information |
|---|
| >PF04140 ICMT: Isoprenylcysteine carboxyl methyltransferase (ICMT) family ; InterPro: IPR007269 The isoprenylcysteine o-methyltransferase (2 | Back alignment and domain information |
|---|
| >KOG0013|consensus | Back alignment and domain information |
|---|
| >PF15044 CLU_N: Mitochondrial function, CLU-N-term | Back alignment and domain information |
|---|
| >KOG1769|consensus | Back alignment and domain information |
|---|
| >PF10209 DUF2340: Uncharacterized conserved protein (DUF2340); InterPro: IPR018794 This entry consists of small proteins of approximately 150 amino acids whose function is unknown | Back alignment and domain information |
|---|
| >cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >KOG2628|consensus | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >cd01767 UBX UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
| >PF13019 Telomere_Sde2: Telomere stability and silencing | Back alignment and domain information |
|---|
| >TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal | Back alignment and domain information |
|---|
| >PF10407 Cytokin_check_N: Cdc14 phosphatase binding protein N-terminus ; InterPro: IPR018844 Cytokinesis in yeasts involves a family of proteins whose essential function is to bind Cdc14-family phosphatase and prevent this from being sequestered and inhibited in the nucleolus | Back alignment and domain information |
|---|
| >cd01770 p47_UBX p47-like ubiquitin domain | Back alignment and domain information |
|---|
| >COG1755 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PLN02799 Molybdopterin synthase sulfur carrier subunit | Back alignment and domain information |
|---|
| >cd00754 MoaD Ubiquitin domain of MoaD-like proteins | Back alignment and domain information |
|---|
| >cd01772 SAKS1_UBX SAKS1-like UBX domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 233 | |||
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 7e-20 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 5e-08 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 2e-06 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 1e-05 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 1e-05 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 2e-05 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 3e-05 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 3e-05 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 3e-05 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 3e-05 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 4e-05 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 9e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 2e-04 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 2e-04 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 5e-04 |
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
Score = 80.0 bits (197), Expect = 7e-20
Identities = 22/59 (37%), Positives = 33/59 (55%)
Query: 1 VSGSFTVKDIKKEVHKAKSQLYPDRQAVRLEIKGKILKDSDDIKSLGLKNGDMVFIKDL 59
V T+ +IK K Q YP RQ++RL+ KGK LKD D ++ L + ++ +DL
Sbjct: 30 VEPHATIAEIKNLFTKTHPQWYPARQSLRLDPKGKSLKDEDVLQKLPVGTTATLYFRDL 88
|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Length = 107 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Length = 90 | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 233 | |||
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 99.66 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 99.56 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 99.54 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 99.53 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 99.52 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 99.49 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 99.49 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 99.47 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 99.46 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 99.45 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 99.44 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 99.44 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 99.43 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 99.42 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 99.42 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 99.41 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 99.41 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 99.4 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 99.4 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 99.4 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 99.4 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 99.4 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 99.39 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 99.39 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 99.39 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 99.39 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 99.39 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 99.39 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 99.39 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 99.38 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 99.38 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 99.38 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 99.38 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 99.38 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 99.38 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 99.38 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 99.37 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 99.37 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 99.36 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 99.36 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.36 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 99.36 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 99.36 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 99.35 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 99.35 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 99.35 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 99.35 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 99.34 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 99.34 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 99.33 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 99.33 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 99.32 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 99.32 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 99.31 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 98.98 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 99.3 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 99.29 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 99.28 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 99.28 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 99.28 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.28 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 99.27 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 99.27 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 99.24 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 99.23 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 99.23 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 99.23 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 99.23 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 99.23 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.23 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 99.21 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 99.21 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 99.18 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 99.17 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.16 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 99.16 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 99.15 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.15 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.15 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.15 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.14 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 99.14 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 99.13 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 98.92 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 98.91 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 98.9 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 98.74 | |
| 4a2n_B | 194 | Isoprenylcysteine carboxyl methyltransferase; memb | 98.74 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 98.71 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 98.68 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 98.64 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 98.59 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 98.45 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 98.4 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 98.4 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 98.32 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 97.96 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 97.77 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 97.73 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 97.6 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 97.55 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 97.53 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 97.21 | |
| 2kc2_A | 128 | Talin-1, F1; FERM, adhesion, cell membrane, cell p | 96.95 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 96.7 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 96.34 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 96.29 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 95.43 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 95.33 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 94.55 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 93.0 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 92.61 | |
| 2daj_A | 91 | KIAA0977 protein, COBL-like 1; ubiquitin-like doma | 91.75 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 91.29 | |
| 4e71_A | 111 | Plexin-B2, MM1; transmembrane, signaling, RBD, str | 91.28 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 90.7 | |
| 2r2o_A | 138 | Plexin-B1; effector domain, structural genomics, s | 90.35 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 87.97 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 87.95 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 87.08 | |
| 2kvr_A | 130 | Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi | 87.02 | |
| 1wj4_A | 124 | KIAA0794 protein; UBX domain, beta-grAsp fold, str | 86.47 | |
| 1y8x_B | 98 | Ubiquitin-activating enzyme E1C; ubiquitin-conjuga | 86.18 | |
| 3h6n_A | 127 | Plexin-D1; structural genomics consortium, SGC, me | 85.36 | |
| 3onh_A | 127 | Ubiquitin-activating enzyme E1-like; ligase, SUMO | 85.04 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 83.63 | |
| 1s3s_G | 127 | P47 protein; AAA ATPase, protein-protein complex, | 83.47 | |
| 4e74_A | 117 | Plexin-A4; RBD, structural genomics, structural ge | 83.01 |
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.66 E-value=4e-17 Score=121.42 Aligned_cols=59 Identities=37% Similarity=0.587 Sum_probs=55.3
Q ss_pred CCCcccHHHHHHHHHHHhCCCCcCceeEEEcCCCcccCCchhhhhcCCCCCceEEEecC
Q psy9586 1 VSGSFTVKDIKKEVHKAKSQLYPDRQAVRLEIKGKILKDSDDIKSLGLKNGDMVFIKDL 59 (233)
Q Consensus 1 v~~~~TV~~LK~~i~~~~~~i~~~rQrL~~~~~Gk~L~d~ktL~~ygv~~~~tl~vkdl 59 (233)
|++++||+|||++|+++.+|+||+||||++..+|++|+|+++|++||+++|+||++|||
T Consensus 30 v~~~~TV~~lK~~I~~~~~~i~~~~QrL~~~~~Gk~L~D~~tL~~y~i~~~stl~~KDL 88 (88)
T 2dzj_A 30 VEPHATIAEIKNLFTKTHPQWYPARQSLRLDPKGKSLKDEDVLQKLPVGTTATLYFRDL 88 (88)
T ss_dssp ECSSCBHHHHHHHHHHHCSSSCTTTCCEESSTTSCCCCTTCBTTTSSCCSEEEEEECCC
T ss_pred cCCCCcHHHHHHHHHHHhcCCChHHeEEEecCCCcCcCCCCCHHHcCCCCCCEEEEEeC
Confidence 47899999999999995489999999999977899999999999999999999999997
|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >4a2n_B Isoprenylcysteine carboxyl methyltransferase; membrane protein, RAS and RHO gtpases signallin; HET: SAH PLM CDL; 3.40A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
| >4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A | Back alignment and structure |
|---|
| >3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A | Back alignment and structure |
|---|
| >4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 233 | ||||
| d1v5ta_ | 90 | d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu | 2e-05 | |
| d2bwfa1 | 73 | d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc | 6e-05 | |
| d1wjna_ | 97 | d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse | 9e-05 | |
| d1x1ma1 | 94 | d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse | 6e-04 | |
| d1wgda_ | 93 | d.15.1.1 (A:) Homocysteine-responsive endoplasmic | 7e-04 | |
| d1oqya4 | 77 | d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h | 9e-04 | |
| d1uela_ | 95 | d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol | 0.004 |
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: 8430435i17rik protein species: Mouse (Mus musculus) [TaxId: 10090]
Score = 40.0 bits (93), Expect = 2e-05
Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 5/68 (7%)
Query: 1 VSGSFTVKDIKKEVHKAKSQLYPDRQA-VRLEIKGKILKDSDDIKSLGLKNGD---MVFI 56
+S TV D+K+ + + + P+RQ + L++KGK ++ + +L LK M+
Sbjct: 24 LSEDDTVLDLKQFLKT-LTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGT 82
Query: 57 KDLGPQIG 64
++ GP G
Sbjct: 83 RESGPSSG 90
|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 233 | |||
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.55 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 99.52 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.51 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 99.5 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 99.5 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.5 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.5 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.49 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 99.49 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 99.47 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 99.45 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 99.44 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 99.43 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 99.43 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 99.42 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 99.38 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 99.37 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 99.37 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 99.36 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 99.35 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 99.32 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 99.3 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 99.27 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 99.26 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 99.26 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 99.23 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 99.22 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 99.21 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 99.19 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 99.16 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 99.15 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 99.12 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 99.06 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 98.9 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 98.57 | |
| d1wf9a1 | 94 | NPL4-like protein 1 {Thale cress (Arabidopsis thal | 97.78 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 97.3 | |
| d1y8xb1 | 92 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 92.59 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 91.92 | |
| d1wj4a_ | 124 | Hypothetical protein KIAA0794 {Human (Homo sapiens | 91.2 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 90.8 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 88.94 | |
| d1i42a_ | 89 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 88.51 |
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: Interferon-induced 15 kDa protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.55 E-value=2.6e-15 Score=106.81 Aligned_cols=55 Identities=24% Similarity=0.371 Sum_probs=52.5
Q ss_pred CCCcccHHHHHHHHHHHhCCCCcCceeEEEcCCCcccCCchhhhhcCCCCCceEEE
Q psy9586 1 VSGSFTVKDIKKEVHKAKSQLYPDRQAVRLEIKGKILKDSDDIKSLGLKNGDMVFI 56 (233)
Q Consensus 1 v~~~~TV~~LK~~i~~~~~~i~~~rQrL~~~~~Gk~L~d~ktL~~ygv~~~~tl~v 56 (233)
|++++||++||++|+++ .|+|+++|||+|.++|+.|+|+++|++||+++|++|++
T Consensus 17 V~~~~tV~~lK~~I~~~-~gip~~~QrLi~~~~Gk~L~D~~tL~~y~i~~g~~i~l 71 (76)
T d1z2ma1 17 LSSSMSVSELKAQITQK-IGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLL 71 (76)
T ss_dssp CCSSCCHHHHHHHHHHH-HCCCGGGEEEEEETTCCBCCSSSCSGGGTCCTTCEEEE
T ss_pred ECCCCcHHHHHHHHHHH-hccCCccEEEEEcCCCeeccCCCcHHHcCCCCCCEEEE
Confidence 57899999999999999 89999999999987899999999999999999999986
|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|