Diaphorina citri psyllid: psy958


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MLVPEYLGTRYSRSERFDDHFIEKCDKYLGNFIYVDTVRAIIKKELRPPQVLDIEDEEAKLDGSDVLFTGISKWTNEKGARAVADSFPEYPCTAIKVKNKNPKAKMSTSTGIDQLLVRTQVEMFLNDSRLGNRGQQV
cccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHccccccEEEEcccccEECcccEEEEEcccccHHHHHHHHHHHcccccCEEEEcccccccccccccccccEEEEEcccHHHHHHHHHHcccccc
*LVPEYLGTRYSRSERFDDHFIEKCDKYLGNFIYVDTVRAIIKKELRPPQVLDIEDEEAKLDGSDVLFTGISKWTNEKGARAVADSFPEYPCTAIKVKNKNPKAKMSTSTGIDQLLVRTQVEMFL************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVPEYLGTRYSRSERFDDHFIEKCDKYLGNFIYVDTVRAIIKKELRPPQVLDIEDEEAKLDGSDVLFTGISKWTNEKGARAVADSFPEYPCTAIKVKNKNPKAKMSTSTGIDQLLVRTQVEMFLNDSRLGNRGQQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:1901605 [BP]alpha-amino acid metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044237, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CI1, chain A
Confidence level:very confident
Coverage over the Query: 16-122
View the alignment between query and template
View the model in PyMOL