Diaphorina citri psyllid: psy9590

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350

MVKGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDLPEWKKHVIGGKKSSFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDGHP

ccccHHHHHHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHcccccccccccEEccccccccccccccEEEEEccccHHcccccccccccccEECccccccHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHccccccEEECccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccEEEEcHHHHHHHHccccccccccEEEECcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEECccCECcccccccccccccccccccEEEEECccccccc

MVKGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDLPEWK*********SFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQD***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5	Could act late in the splicing of pre-mRNA and mediate the release of the spliced mRNA from spliceosomes.	confident	Q09530
Probable pre-mRNA-splicing factor ATP-dependent RNA helicase	Could act late in the splicing of pre-mRNA and mediate the release of the spliced mRNA from spliceosomes.	confident	Q38953
ATP-dependent RNA helicase DHX8	Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.	confident	Q14562

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044428 [CC]	nuclear part	confident	GO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0007286 [BP]	spermatid development	probable	GO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0030686 [CC]	90S preribosome	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0010172 [BP]	embryonic body morphogenesis	probable	GO:0048598, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0010171, GO:0009653, GO:0007275, GO:0044699
GO:0070054 [BP]	mRNA splicing, via endonucleolytic cleavage and ligation	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000394, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0051301 [BP]	cell division	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0005689 [CC]	U12-type spliceosomal complex	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0004004 [MF]	ATP-dependent RNA helicase activity	probable	GO:0016787, GO:0016818, GO:0008026, GO:0042623, GO:0003824, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003724, GO:0003674, GO:0016887, GO:0008186, GO:0016462
GO:0022008 [BP]	neurogenesis	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0040020 [BP]	regulation of meiosis	probable	GO:0051445, GO:0051726, GO:2000241, GO:0010564, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0040022 [BP]	feminization of hermaphroditic germ-line	probable	GO:0032502, GO:0022414, GO:0032501, GO:0040021, GO:0044707, GO:0018992, GO:0000003, GO:0003006, GO:0008150, GO:0007275, GO:0044699, GO:0007530
GO:0042127 [BP]	regulation of cell proliferation	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0045943 [BP]	positive regulation of transcription from RNA polymerase I promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0006356, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0060215 [BP]	primitive hemopoiesis	probable	GO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048568, GO:0048856, GO:0035162, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0018996 [BP]	molting cycle, collagen and cuticulin-based cuticle	probable	GO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0048589 [BP]	developmental growth	probable	GO:0044767, GO:0032502, GO:0008150, GO:0040007, GO:0044699
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0000182 [MF]	rDNA binding	probable	GO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000349 [BP]	generation of catalytic spliceosome for first transesterification step	probable	GO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000393, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0002009 [BP]	morphogenesis of an epithelium	probable	GO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0000381 [BP]	regulation of alternative mRNA splicing, via spliceosome	probable	GO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0048024, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XAU, chain A
Confidence level:very confident
Coverage over the Query: 126-349
View the alignment between query and template
View the model in PyMOL

Template: 2XAU, chain A
Confidence level:very confident
Coverage over the Query: 1-105
View the alignment between query and template
View the model in PyMOL