Psyllid ID: psy9590

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350
MVKGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDLPEWKKHVIGGKKSSFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDGHP
ccccHHHHHHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHcccccccccccEEccccccccccccccEEEEEccccHHcccccccccccccEEEccccccHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccEEEEcHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEccEEEcccccccccccccccccccEEEEEEccccccc
ccccHHHHHHHHHHHHHHHHHHccccccEEEEEcHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEccccccccccEEEEccccHHcHHHHHHccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEcccHHHHHHHHccccHcccEEEEEccHHHHHHHHHHHHHHHHHHHHcccHHHcEEEEEcccccHHHHHHHHccccccccEEEcccccccEEEEEccccccHHHHHHHHHEEccccccccc
MVKGQEEIDTACEILYERMKslgpdvpeliilpvysalpsemqtrifeaappgsrkvVIATNiaetsltidgifyvvdpgfVKQKvynsktgmdslvvtpisqdlpewkkhviggkkssfgkktnLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIgetgsgktTQITQYLAEAgftargkigctqpRRVAAMSVAKRVAEEFGCrlgqevgytirfedctsSETLIKYMTDGMLLRECLVDldlnnysvimldeahertihtdvlfdptklskfkknqrleplynkyeepnawrISRVVIATNIaetsltidgifyvvdpgfVKQKvynsktgmdslvvtpisqdghp
mvkgqeeiDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFeaappgsrkVVIATNIAETSLTIDGIFYVVDPGFVKQKVynsktgmdSLVVTpisqdlpewkkhviggkkssfgkktnltiveqRQSLPIYKLKHELIKAVSDNQILIVIGetgsgkttQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFgcrlgqevgytirfedctSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTdvlfdptklskfkknqrleplynkyeepnawrISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVynsktgmdslvvtpisqdghp
MVKGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDLPEWKKHVIGGKKSSFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDGHP
********DTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDLPEWKKHVIGGKKSSFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLV**********
MVKGQEEIDTACEILYERM******VPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDL***************GKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTKLSKFK************EEPNAWRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQD***
MVKGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDLPEWKKHVIGGKKSSFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDGHP
MVKGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDLPEWK*********SFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPIS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDLPEWKKHVIGGKKSSFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQDGHP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query350 2.2.26 [Sep-21-2011]
Q14562 1220 ATP-dependent RNA helicas yes N/A 0.48 0.137 0.815 5e-81
A2A4P0 1244 ATP-dependent RNA helicas yes N/A 0.48 0.135 0.815 5e-81
Q38953 1168 Probable pre-mRNA-splicin yes N/A 0.468 0.140 0.781 8e-74
Q09530 1200 Probable pre-mRNA-splicin yes N/A 0.502 0.146 0.710 2e-73
Q54F05 1160 ATP-dependent RNA helicas yes N/A 0.477 0.143 0.708 9e-67
O42643 1168 Pre-mRNA-splicing factor yes N/A 0.477 0.142 0.662 5e-60
P24384 1145 Pre-mRNA-splicing factor yes N/A 0.488 0.149 0.639 7e-60
Q54MH3 1106 Putative pre-mRNA-splicin no N/A 0.457 0.144 0.633 6e-56
O45244 1008 Probable pre-mRNA-splicin no N/A 0.462 0.160 0.621 6e-55
Q17R09 1227 Pre-mRNA-splicing factor no N/A 0.425 0.121 0.675 1e-54
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function desciption
 Score =  301 bits (771), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 137/168 (81%), Positives = 155/168 (92%)

Query: 101 ISQDLPEWKKHVIGGKKSSFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGET 160
           +  D+PEWKKH  GG K+S+GKKT ++I+EQR+SLPIYKLK +L++AV DNQILIVIGET
Sbjct: 531 MPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGET 590

Query: 161 GSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFED 220
           GSGKTTQITQYLAEAG+T+RGKIGCTQPRRVAAMSVAKRV+EEFGC LGQEVGYTIRFED
Sbjct: 591 GSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFED 650

Query: 221 CTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLF 268
           CTS ET+IKYMTDGMLLRECL+D DL  Y++IMLDEAHERTIHTDVLF
Sbjct: 651 CTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLF 698
Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function description
>sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 Back     alignment and function description
>sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 Back     alignment and function description
>sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 Back     alignment and function description
>sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 Back     alignment and function description
>sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query350
410932209 756 PREDICTED: ATP-dependent RNA helicase DH 0.702 0.325 0.618 5e-91
270013243 1181 hypothetical protein TcasGA2_TC011820 [T 0.477 0.141 0.934 8e-88
242012890 1236 pre-mRNA-splicing factor ATP-dependent R 0.48 0.135 0.916 9e-88
189241238 1247 PREDICTED: similar to CG8241 CG8241-PA [ 0.477 0.133 0.934 1e-87
340727152 1197 PREDICTED: ATP-dependent RNA helicase DH 0.477 0.139 0.916 8e-87
350402222 1197 PREDICTED: ATP-dependent RNA helicase DH 0.477 0.139 0.916 8e-87
383854100 1200 PREDICTED: ATP-dependent RNA helicase DH 0.477 0.139 0.916 9e-87
328710981 1251 PREDICTED: ATP-dependent RNA helicase DH 0.477 0.133 0.916 3e-86
345489444 1216 PREDICTED: ATP-dependent RNA helicase DH 0.477 0.137 0.898 5e-86
345489442 1203 PREDICTED: ATP-dependent RNA helicase DH 0.477 0.138 0.898 5e-86
>gi|410932209|ref|XP_003979486.1| PREDICTED: ATP-dependent RNA helicase DHX8-like, partial [Takifugu rubripes] Back     alignment and taxonomy information
 Score =  340 bits (873), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 175/283 (61%), Positives = 206/283 (72%), Gaps = 37/283 (13%)

Query: 101 ISQDLPEWKKHVIGGKKSSFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGET 160
           +  D+PEWKKH  GG K+S+GKKT L+I+EQR+SLPIYKLK +L++AV +NQILIVIGET
Sbjct: 422 MPNDMPEWKKHAFGGNKASYGKKTQLSILEQRESLPIYKLKEQLVQAVHENQILIVIGET 481

Query: 161 GSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFED 220
           GSGKTTQITQYLAEAG+T+RGKIGCTQPRRVAAMSVAKRV+EE+GC LGQEVGYTIRFED
Sbjct: 482 GSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFED 541

Query: 221 CTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLF------------ 268
           CTS ET+IKYMTDGMLLRECL+D +L  Y++IMLDEAHERTIHTDVLF            
Sbjct: 542 CTSPETVIKYMTDGMLLRECLIDSELGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTD 601

Query: 269 ----------DPTKLSKF----------KKNQRLEPLYNKYEEPNAWRISRV-VIATNIA 307
                     D  K S++           +   +E LY K  E +    S + V+  ++ 
Sbjct: 602 MKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLT 661

Query: 308 E----TSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQ 346
           E          GI+YVVDPGFVKQKVYNSKTG+D LVVTPISQ
Sbjct: 662 EPPXXXXXXXXGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQ 704

Source: Takifugu rubripes

Species: Takifugu rubripes

Genus: Takifugu

Family: Tetraodontidae

Order: Tetraodontiformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|270013243|gb|EFA09691.1| hypothetical protein TcasGA2_TC011820 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242012890|ref|XP_002427158.1| pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22, putative [Pediculus humanus corporis] gi|212511441|gb|EEB14420.1| pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|189241238|ref|XP_972602.2| PREDICTED: similar to CG8241 CG8241-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340727152|ref|XP_003401914.1| PREDICTED: ATP-dependent RNA helicase DHX8-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350402222|ref|XP_003486410.1| PREDICTED: ATP-dependent RNA helicase DHX8-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383854100|ref|XP_003702560.1| PREDICTED: ATP-dependent RNA helicase DHX8 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328710981|ref|XP_001948871.2| PREDICTED: ATP-dependent RNA helicase DHX8-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345489444|ref|XP_001606022.2| PREDICTED: ATP-dependent RNA helicase DHX8-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345489442|ref|XP_003426140.1| PREDICTED: ATP-dependent RNA helicase DHX8-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query350
FB|FBgn0086895 1242 pea "peanuts" [Drosophila mela 0.568 0.160 0.752 5.9e-98
UNIPROTKB|F1P306 1168 LOC100858239 "Uncharacterized 0.585 0.175 0.697 5.1e-94
UNIPROTKB|F1S1H3 1212 DHX8 "Uncharacterized protein" 0.5 0.144 0.794 2.3e-93
UNIPROTKB|E2R9R9 1216 DHX8 "Uncharacterized protein" 0.5 0.143 0.794 2.4e-93
UNIPROTKB|F1MEM4 1230 DHX8 "Uncharacterized protein" 0.5 0.142 0.794 2.7e-93
UNIPROTKB|F5H658 1181 DHX8 "ATP-dependent RNA helica 0.5 0.148 0.794 2.8e-93
RGD|1310723 1210 Dhx8 "DEAH (Asp-Glu-Ala-His) b 0.5 0.144 0.794 3.8e-93
UNIPROTKB|Q14562 1220 DHX8 "ATP-dependent RNA helica 0.5 0.143 0.794 4.2e-93
ZFIN|ZDB-GENE-050809-39 1210 dhx8 "DEAH (Asp-Glu-Ala-His) b 0.5 0.144 0.8 4.9e-93
UNIPROTKB|D4A805 1242 Dhx8 "Protein Dhx8" [Rattus no 0.5 0.140 0.794 5.1e-93
FB|FBgn0086895 pea "peanuts" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 773 (277.2 bits), Expect = 5.9e-98, Sum P(2) = 5.9e-98
 Identities = 152/202 (75%), Positives = 172/202 (85%)

Query:    77 VDPGFVKQKVYNSKTGMDSLVVTPISQDLPEWKKHVIGGKKSSFGKKTNLTIVEQRQSLP 136
             +DP   + +  +    M  +   P   ++PEWKKHVIGGKKSSFGKKT+LT+VEQRQSLP
Sbjct:   531 IDP-LPEDESRSLAANMRGMAAAP--PEVPEWKKHVIGGKKSSFGKKTDLTLVEQRQSLP 587

Query:   137 IYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSV 196
             IYKL+ +LIKAV+DNQILIVIGETGSGKTTQITQYL E GFTARGKIGCTQPRRVAAMSV
Sbjct:   588 IYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSV 647

Query:   197 AKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDE 256
             AKRVAEE+GCRLGQEVGYTIRFEDCTS ET+IKYMTDGMLLRECL++ +L +YSVIMLDE
Sbjct:   648 AKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDE 707

Query:   257 AHERTIHTDVLFDPTKLSKFKK 278
             AHERTIHTDVLF   K +  K+
Sbjct:   708 AHERTIHTDVLFGLLKTAVQKR 729
GO:0007286 "spermatid development" evidence=IMP
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IC
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|F1P306 LOC100858239 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1H3 DHX8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9R9 DHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEM4 DHX8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F5H658 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1310723 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q14562 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050809-39 dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D4A805 Dhx8 "Protein Dhx8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q09530MOG5_CAEEL3, ., 6, ., 4, ., 1, 30.71020.50280.1466yesN/A
Q14562DHX8_HUMAN3, ., 6, ., 4, ., 1, 30.81540.480.1377yesN/A
A2A4P0DHX8_MOUSE3, ., 6, ., 4, ., 1, 30.81540.480.1350yesN/A
Q54F05DHX8_DICDI3, ., 6, ., 4, ., 1, 30.70830.47710.1439yesN/A
O42643PRP22_SCHPO3, ., 6, ., 4, ., 1, 30.66270.47710.1429yesN/A
Q38953DHX8_ARATH3, ., 6, ., 4, ., 1, 30.78180.46850.1404yesN/A
P24384PRP22_YEAST3, ., 6, ., 4, ., 1, 30.63950.48850.1493yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query350
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-70
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-45
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-44
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 2e-39
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 5e-28
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 4e-25
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 2e-23
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 1e-21
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 4e-21
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 4e-19
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 8e-19
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 2e-16
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-15
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 8e-11
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-10
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 2e-10
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-09
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-09
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 6e-05
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  235 bits (601), Expect = 1e-70
 Identities = 81/147 (55%), Positives = 108/147 (73%)

Query: 122 KKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARG 181
                 I+E R  LP+  ++ E++KA+  NQ++I++GETGSGKTTQ+ Q+L E G    G
Sbjct: 36  SANVPDILEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEGLGIAG 95

Query: 182 KIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECL 241
           KIGCTQPRR+AA SVA+RVAEE G +LG+ VGY+IRFE   S  T IK MTDG+LLRE  
Sbjct: 96  KIGCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIKVMTDGILLREIQ 155

Query: 242 VDLDLNNYSVIMLDEAHERTIHTDVLF 268
            D  L+ YSV+++DEAHER+++TD+L 
Sbjct: 156 NDPLLSGYSVVIIDEAHERSLNTDILL 182

Length = 845
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 350
KOG0922|consensus 674 100.0
KOG0923|consensus 902 100.0
KOG0924|consensus 1042 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0925|consensus 699 100.0
KOG0926|consensus 1172 100.0
KOG0920|consensus 924 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0923|consensus902 100.0
KOG0922|consensus674 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.98
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.98
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.97
KOG0924|consensus 1042 99.97
KOG0925|consensus699 99.96
KOG0920|consensus 924 99.94
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.93
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.93
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.92
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.91
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.91
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.91
KOG0926|consensus 1172 99.9
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.9
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.9
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.9
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.9
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.9
COG1127263 Ttg2A ABC-type transport system involved in resist 99.89
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.89
COG4152300 ABC-type uncharacterized transport system, ATPase 99.88
PRK13537306 nodulation ABC transporter NodI; Provisional 99.88
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.88
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.88
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.88
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.88
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.87
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.87
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.87
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.87
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.87
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.87
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.87
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.87
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.87
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.87
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.87
COG4586325 ABC-type uncharacterized transport system, ATPase 99.87
COG0410237 LivF ABC-type branched-chain amino acid transport 99.87
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.87
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.87
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.86
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.86
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.86
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.86
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.86
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.86
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.86
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.86
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.86
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.86
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.86
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.86
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.86
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.86
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.86
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.86
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.86
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.86
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.85
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.85
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.85
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.85
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.85
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.85
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.85
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.85
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.85
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.85
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 99.85
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.85
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.85
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.85
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.85
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.85
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.85
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.85
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.85
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.85
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.85
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.85
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.85
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.85
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.85
COG0411250 LivG ABC-type branched-chain amino acid transport 99.85
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.85
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.85
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.84
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.84
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.84
PRK10908222 cell division protein FtsE; Provisional 99.84
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.84
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.84
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.84
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.84
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.84
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.84
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.84
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.84
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.84
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.84
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.84
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.84
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.84
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.84
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.84
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.84
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.84
cd03246173 ABCC_Protease_Secretion This family represents the 99.84
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.83
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.83
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.83
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.83
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.83
KOG0921|consensus 1282 99.83
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.83
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.83
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.83
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.83
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.83
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.83
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.83
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.83
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.83
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.83
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.83
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.83
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.83
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.83
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.83
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.83
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.83
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.83
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.83
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.83
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.83
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.83
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.83
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.83
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.83
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.83
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.83
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.82
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.82
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.82
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.82
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.82
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.82
KOG0058|consensus716 99.82
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.82
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.82
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.82
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.82
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.82
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.82
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.82
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.82
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.82
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.82
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.82
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.82
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.82
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.82
cd03234226 ABCG_White The White subfamily represents ABC tran 99.82
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.82
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.82
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.82
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.82
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.82
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
PRK09984262 phosphonate/organophosphate ester transporter subu 99.82
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.82
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.82
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.82
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.82
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.82
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.81
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.81
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.81
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.81
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.81
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.81
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.81
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.81
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.81
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.81
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.81
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.81
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.81
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.81
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.81
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK10938 490 putative molybdenum transport ATP-binding protein 99.81
PHA02653 675 RNA helicase NPH-II; Provisional 99.81
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.81
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.81
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.81
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.81
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.81
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.81
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.81
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.81
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.81
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.81
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.81
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.81
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.81
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.81
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.81
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.8
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.8
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.8
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.8
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.8
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.8
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.8
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.8
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.8
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.8
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.8
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.8
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.8
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.8
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.8
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.8
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.8
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.8
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.8
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 99.8
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.8
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.79
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.79
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.79
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.79
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.79
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.79
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.79
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.79
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.79
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.79
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.79
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.79
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.79
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.79
PRK11147 635 ABC transporter ATPase component; Reviewed 99.79
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.79
COG1123 539 ATPase components of various ABC-type transport sy 99.79
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.79
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.79
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.79
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.78
PLN03073718 ABC transporter F family; Provisional 99.78
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.78
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.78
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.78
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 99.78
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.78
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.78
PRK10938490 putative molybdenum transport ATP-binding protein 99.78
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.78
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.78
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.78
COG1123539 ATPase components of various ABC-type transport sy 99.77
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.77
PRK11147635 ABC transporter ATPase component; Reviewed 99.77
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.77
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.77
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.77
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.77
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.77
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.77
COG4988559 CydD ABC-type transport system involved in cytochr 99.77
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.77
PRK13409590 putative ATPase RIL; Provisional 99.77
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.76
KOG0055|consensus1228 99.76
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.76
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.76
COG4619223 ABC-type uncharacterized transport system, ATPase 99.76
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.76
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.76
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.76
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.76
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.76
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.76
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.76
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.76
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.76
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.76
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.75
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.75
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.75
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.75
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.75
KOG0055|consensus 1228 99.75
COG4987573 CydC ABC-type transport system involved in cytochr 99.75
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.75
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.74
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.74
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.74
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.74
KOG0057|consensus591 99.73
PRK13409 590 putative ATPase RIL; Provisional 99.73
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.72
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.72
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.72
PLN03073 718 ABC transporter F family; Provisional 99.72
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.72
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.71
COG0488 530 Uup ATPase components of ABC transporters with dup 99.71
PLN03211 659 ABC transporter G-25; Provisional 99.71
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.7
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.7
PLN032321495 ABC transporter C family member; Provisional 99.7
PLN03130 1622 ABC transporter C family member; Provisional 99.7
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.7
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.69
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.69
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.69
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.68
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.68
PLN03130 1622 ABC transporter C family member; Provisional 99.67
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.67
PLN03232 1495 ABC transporter C family member; Provisional 99.67
PTZ002431560 ABC transporter; Provisional 99.67
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.67
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.67
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.67
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.66
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.65
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.65
COG4172 534 ABC-type uncharacterized transport system, duplica 99.65
PHA02653675 RNA helicase NPH-II; Provisional 99.65
COG0488530 Uup ATPase components of ABC transporters with dup 99.65
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.65
COG4559259 ABC-type hemin transport system, ATPase component 99.65
PTZ00243 1560 ABC transporter; Provisional 99.64
COG4181228 Predicted ABC-type transport system involved in ly 99.64
KOG0056|consensus790 99.64
COG4172534 ABC-type uncharacterized transport system, duplica 99.63
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.62
KOG0059|consensus885 99.62
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.61
PLN03140 1470 ABC transporter G family member; Provisional 99.6
COG4133209 CcmA ABC-type transport system involved in cytochr 99.6
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.6
KOG0921|consensus 1282 99.6
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.59
KOG0054|consensus 1381 99.58
PLN03140 1470 ABC transporter G family member; Provisional 99.57
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.56
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.55
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.53
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.49
KOG0927|consensus614 99.47
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.47
KOG0054|consensus1381 99.46
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.46
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.45
COG4136213 ABC-type uncharacterized transport system, ATPase 99.44
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.41
KOG2355|consensus291 99.41
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.4
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.37
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.36
KOG0062|consensus 582 99.36
KOG0927|consensus 614 99.35
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.34
KOG0062|consensus582 99.33
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.3
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.29
KOG0061|consensus 613 99.28
COG4178604 ABC-type uncharacterized transport system, permeas 99.27
KOG0066|consensus807 99.24
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.24
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.23
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.22
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.2
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.16
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.15
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.15
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.13
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.12
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.07
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.06
KOG0064|consensus728 99.03
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.0
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 98.98
KOG0060|consensus659 98.98
COG4170330 SapD ABC-type antimicrobial peptide transport syst 98.93
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 98.8
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 98.79
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.79
COG3845501 ABC-type uncharacterized transport systems, ATPase 98.78
KOG0066|consensus 807 98.73
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 98.69
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 98.68
KOG0065|consensus 1391 98.6
KOG0063|consensus592 98.58
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 98.58
PRK00409 782 recombination and DNA strand exchange inhibitor pr 98.5
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 98.37
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 98.36
COG3910233 Predicted ATPase [General function prediction only 98.36
smart00382148 AAA ATPases associated with a variety of cellular 98.36
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 98.25
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.25
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 98.23
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 98.21
KOG0063|consensus 592 98.19
PRK13695174 putative NTPase; Provisional 98.18
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.13
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.12
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 98.12
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.11
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.09
PRK00635 1809 excinuclease ABC subunit A; Provisional 98.05
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.04
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 98.01
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.98
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.98
cd01128249 rho_factor Transcription termination factor rho is 97.97
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 97.96
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.93
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.93
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 97.93
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.92
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 97.89
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.89
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 97.87
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.84
TIGR00634563 recN DNA repair protein RecN. All proteins in this 97.83
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.82
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 97.82
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.82
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 97.81
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.73
PRK01172674 ski2-like helicase; Provisional 97.71
PRK10416318 signal recognition particle-docking protein FtsY; 97.7
PRK10869553 recombination and repair protein; Provisional 97.7
PRK06793432 fliI flagellum-specific ATP synthase; Validated 97.69
PHA02562562 46 endonuclease subunit; Provisional 97.64
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.63
PF1355562 AAA_29: P-loop containing region of AAA domain 97.63
smart00487201 DEXDc DEAD-like helicases superfamily. 97.61
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.6
KOG0065|consensus 1391 97.56
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.56
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 97.52
PRK03918880 chromosome segregation protein; Provisional 97.5
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.49
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 97.46
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.42
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.4
PRK06067234 flagellar accessory protein FlaH; Validated 97.4
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.4
PRK01156895 chromosome segregation protein; Provisional 97.4
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.39
PRK01172 674 ski2-like helicase; Provisional 97.38
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 97.37
>KOG0922|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.7e-57  Score=440.77  Aligned_cols=243  Identities=64%  Similarity=0.968  Sum_probs=223.2

Q ss_pred             cchhhhhcCCCccccCCccchhHHhhhccchhHHHHHHHHHHhhcCCEEEEeCCCCCCHHHHHHHHHhhcCCCCCcEEEE
Q psy9590         106 PEWKKHVIGGKKSSFGKKTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGC  185 (350)
Q Consensus       106 ~~~rr~~~~~k~~~~~~~~~~~i~~~r~~lpi~~~~~~i~~~i~~g~v~~liG~nGsGKSTll~~l~~~~~~~~~G~i~~  185 (350)
                      ++|.++... ....+++.....+.++|.+|||++++++|+.+++++++++|+|+|||||||++|+++...++..+|.|.|
T Consensus        22 ~~~~~~~~~-~~~~~~~~~~~~i~~qR~~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~~g~I~~  100 (674)
T KOG0922|consen   22 PEWKGAVPN-GAQSYGKSTNLSIQEQRESLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFASSGKIAC  100 (674)
T ss_pred             chhcccccc-cccccccccccCHHHhhccCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhcccccCCcEEe
Confidence            444444332 2234455566778999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCcchhhhhHHHHHHHHhcccccchhhhhhhcccCCCccccccccChhHHHHHHHHhhcCCCCcEEEEcCCCccccccc
Q psy9590         186 TQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTD  265 (350)
Q Consensus       186 ~~~~~i~~~~~~~~v~~~~~~~~~~~v~~~~~~~~~~~~~~~i~~lS~G~~qr~~ia~all~~~~viIlDEpher~~~~d  265 (350)
                      +||||++++++++++|.++++.+|+.|||.++|++..+.++++++||+||++|.++.++++.+|++||+||+|||+++||
T Consensus       101 TQPRRVAavslA~RVAeE~~~~lG~~VGY~IRFed~ts~~TrikymTDG~LLRE~l~Dp~LskYsvIIlDEAHERsl~TD  180 (674)
T KOG0922|consen  101 TQPRRVAAVSLAKRVAEEMGCQLGEEVGYTIRFEDSTSKDTRIKYMTDGMLLREILKDPLLSKYSVIILDEAHERSLHTD  180 (674)
T ss_pred             ecCchHHHHHHHHHHHHHhCCCcCceeeeEEEecccCCCceeEEEecchHHHHHHhcCCccccccEEEEechhhhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccChh----------------------HHHhhhh----------cCcccceeccCCccc--------------------
Q psy9590         266 VLFDPT----------------------KLSKFKK----------NQRLEPLYNKYEEPN--------------------  293 (350)
Q Consensus       266 ~ll~~l----------------------~~~~~~~----------~~~v~~~~~~~~~~~--------------------  293 (350)
                      +|+|+|                      +|++||+          +|||+++|.+.+...                    
T Consensus       181 iLlGlLKki~~~R~~LklIimSATlda~kfS~yF~~a~i~~i~GR~fPVei~y~~~p~~dYv~a~~~tv~~Ih~~E~~GD  260 (674)
T KOG0922|consen  181 ILLGLLKKILKKRPDLKLIIMSATLDAEKFSEYFNNAPILTIPGRTFPVEILYLKEPTADYVDAALITVIQIHLTEPPGD  260 (674)
T ss_pred             HHHHHHHHHHhcCCCceEEEEeeeecHHHHHHHhcCCceEeecCCCCceeEEeccCCchhhHHHHHHHHHHHHccCCCCC
Confidence            999998                      9999998          899999999866440                    


Q ss_pred             ---------------------------cc-------------------------ceeEEEEEecccccccccCCEEEEEe
Q psy9590         294 ---------------------------AW-------------------------RISRVVIATNIAETSLTIDGIFYVVD  321 (350)
Q Consensus       294 ---------------------------~~-------------------------~~~~vi~sT~iae~s~ti~d~~~vid  321 (350)
                                                 .|                         +.||||+||||||||+||+|++||||
T Consensus       261 ILvFLtGqeEIe~~~~~l~e~~~~~~~~~~~~~lply~aL~~e~Q~rvF~p~p~g~RKvIlsTNIAETSlTI~GI~YVVD  340 (674)
T KOG0922|consen  261 ILVFLTGQEEIEAACELLRERAKSLPEDCPELILPLYGALPSEEQSRVFDPAPPGKRKVILSTNIAETSLTIDGIRYVVD  340 (674)
T ss_pred             EEEEeCCHHHHHHHHHHHHHHhhhccccCcceeeeecccCCHHHhhccccCCCCCcceEEEEcceeeeeEEecceEEEEc
Confidence                                       00                         23999999999999999999999999


Q ss_pred             CCeeeeEeeecCCCcceeeEeecccCCC
Q psy9590         322 PGFVKQKVYNSKTGMDSLVVTPISQDGH  349 (350)
Q Consensus       322 ~G~~~~~~~~~~~~~~~l~~~~is~~~a  349 (350)
                      +|++|++.|||++|++.|...|||||||
T Consensus       341 sG~vK~~~y~p~~g~~~L~v~~ISkasA  368 (674)
T KOG0922|consen  341 SGFVKQKKYNPRTGLDSLIVVPISKASA  368 (674)
T ss_pred             CCceEEEeeccccCccceeEEechHHHH
Confidence            9999999999999999999999999998

>KOG0923|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2355|consensus Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>KOG0064|consensus Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>KOG0063|consensus Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>KOG0063|consensus Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query350
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 5e-43
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 6e-14
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 5e-43
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 6e-14
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 2e-22
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  171 bits (433), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 81/143 (56%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
Query: 128 IVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQY--LAEAGFTARGKIGC 185
           I++ R+ LP++  + E +K   +NQI++ +GETGSGKTTQI Q+    E       ++ C
Sbjct: 86  ILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVAC 145
Query: 186 TQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLD 245
           TQPRRVAAMSVA+RVAEE   +LG+EVGY+IRFE+ TS++T++KYMTDGMLLRE + D D
Sbjct: 146 TQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHD 205
Query: 246 LNNYSVIMLDEAHERTIHTDVLF 268
           L+ YS I+LDEAHERT+ TD+L 
Sbjct: 206 LSRYSCIILDEAHERTLATDILM 228
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query350
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 4e-91
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 3e-56
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 2e-28
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 8e-86
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 3e-46
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 6e-25
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 2e-15
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 8e-45
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 2e-22
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 3e-13
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 4e-44
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 1e-25
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 9e-15
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-42
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-22
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-15
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 5e-39
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-23
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-13
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 6e-39
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 1e-23
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 1e-14
1yks_A 440 Genome polyprotein [contains: flavivirin protease 8e-37
1yks_A440 Genome polyprotein [contains: flavivirin protease 8e-23
1yks_A 440 Genome polyprotein [contains: flavivirin protease 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  287 bits (737), Expect = 4e-91
 Identities = 85/170 (50%), Positives = 117/170 (68%), Gaps = 5/170 (2%)

Query: 104 DLPEWKKHVIGGKKSSFGK---KTNLTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGET 160
              E +K   G      G+      + I++ R+ LP++  + E +K   +NQI++ +GET
Sbjct: 59  SAEEAQKLEDGKINPFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGET 118

Query: 161 GSGKTTQITQYLA--EAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRF 218
           GSGKTTQI Q++   E       ++ CTQPRRVAAMSVA+RVAEE   +LG+EVGY+IRF
Sbjct: 119 GSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRF 178

Query: 219 EDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLF 268
           E+ TS++T++KYMTDGMLLRE + D DL+ YS I+LDEAHERT+ TD+L 
Sbjct: 179 ENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILM 228
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query350
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.95
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.91
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.9
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.9
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.9
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.9
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.89
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.89
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.89
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.89
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.89
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.89
1g6h_A257 High-affinity branched-chain amino acid transport 99.89
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.89
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.89
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.89
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.88
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.88
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.88
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.88
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.88
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.88
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.88
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.87
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.87
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.87
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.86
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.86
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.86
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.86
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.86
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.86
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.86
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.86
2ghi_A260 Transport protein; multidrug resistance protein, M 99.85
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.85
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.84
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.82
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.82
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.8
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.8
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.8
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.8
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.8
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.79
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.79
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.78
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.77
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.76
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.75
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.75
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.75
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.74
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.73
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.72
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.71
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.7
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.7
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.7
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.69
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.65
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.65
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.59
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.57
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.54
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.51
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.51
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.48
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.48
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.46
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.46
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.44
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.43
1e69_A322 Chromosome segregation SMC protein; structural mai 99.42
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.33
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.31
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.3
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.29
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.25
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.24
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 99.23
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.21
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.16
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.14
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.14
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.13
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.13
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.12
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.09
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.09
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.06
2og2_A359 Putative signal recognition particle receptor; nuc 99.04
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.04
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 99.03
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.02
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.01
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.0
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 98.98
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.97
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 98.97
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 98.96
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.96
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.91
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.86
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 98.84
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.83
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.83
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 98.82
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.82
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.81
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.79
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 98.78
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 98.77
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.75
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 98.74
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.74
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.71
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.7
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 98.69
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.69
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.68
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.66
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.64
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.61
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 98.6
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 98.59
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.56
2ewv_A372 Twitching motility protein PILT; pilus retraction 98.54
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.54
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.53
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.46
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.45
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.45
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.44
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.43
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 98.4
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 98.39
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.37
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 98.36
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 98.35
3kta_B173 Chromosome segregation protein SMC; structural mai 98.34
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 98.33
1yks_A440 Genome polyprotein [contains: flavivirin protease 98.33
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.32
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.31
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 98.3
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.29
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.29
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 98.24
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.24
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 98.22
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 98.19
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.19
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.18
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.11
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.11
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.11
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 98.1
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.08
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.08
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.08
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.07
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.07
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 98.04
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.03
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.99
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.97
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 97.95
2oap_1511 GSPE-2, type II secretion system protein; hexameri 97.95
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 97.95
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 97.95
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.95
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.93
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.92
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.92
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.91
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 97.9
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.89
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.85
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 97.83
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.83
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.83
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.82
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.78
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.77
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.77
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.77
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.74
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 97.74
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.73
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.72
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 97.72
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.71
1p9r_A418 General secretion pathway protein E; bacterial typ 97.71
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.7
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.7
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.7
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 97.69
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.69
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 97.68
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.68
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.67
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.67
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.65
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 97.65
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 97.64
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.64
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.63
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.59
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.59
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.59
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.58
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.57
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.57
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.55
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.55
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 97.55
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.55
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.54
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 97.54
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.53
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.53
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.52
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.51
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.51
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 97.5
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.48
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 97.48
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 97.48
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 97.47
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.45
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.45
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.45
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 97.45
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.45
3bor_A237 Human initiation factor 4A-II; translation initiat 97.45
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.44
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 97.43
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.43
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.43
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 97.42
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.42
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 97.41
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.41
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.4
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.38
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.38
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.37
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.37
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.36
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 97.36
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.35
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 96.46
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.33
3kta_A182 Chromosome segregation protein SMC; structural mai 97.33
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 97.33
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.33
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.32
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.31
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.31
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.31
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.31
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.31
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.31
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.29
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.29
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.28
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.27
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.24
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.23
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.21
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.18
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 97.13
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.13
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 97.12
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 97.11
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 97.11
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.09
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.09
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.08
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.05
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.98
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 96.97
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.97
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 96.95
4gl2_A 699 Interferon-induced helicase C domain-containing P; 96.95
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.95
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.91
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.9
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.9
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.88
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 96.87
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 96.8
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.8
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 96.8
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 96.78
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.75
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.74
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.73
2z43_A324 DNA repair and recombination protein RADA; archaea 96.72
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 96.7
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.69
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.69
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.67
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.66
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.65
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 96.63
2www_A349 Methylmalonic aciduria type A protein, mitochondri 96.61
4gl2_A699 Interferon-induced helicase C domain-containing P; 96.6
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.58
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.58
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 96.57
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.57
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 96.55
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.55
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.53
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 96.52
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 96.49
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 96.46
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.46
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.44
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.42
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.4
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 96.4
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.37
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.33
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.32
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.32
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 96.3
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.3
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.28
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.25
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 96.24
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 96.22
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.19
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.18
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.18
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.14
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 96.11
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.11
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.1
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.1
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.1
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.1
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.08
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.08
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 96.07
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.06
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 96.06
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.05
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.04
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.99
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.99
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.93
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.93
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 95.9
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.9
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 95.9
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.87
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.86
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.85
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.84
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.84
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.82
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 95.82
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.81
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.81
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.79
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.79
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.78
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.68
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.66
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.63
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.62
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.6
1via_A175 Shikimate kinase; structural genomics, transferase 95.59
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.59
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.58
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.58
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.57
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.55
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 95.53
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.53
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 95.53
1ojl_A304 Transcriptional regulatory protein ZRAR; response 95.5
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.49
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.48
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.47
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.46
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 95.46
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.45
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.44
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.36
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.35
3lxx_A239 GTPase IMAP family member 4; structural genomics c 95.33
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.32
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.29
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.29
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.28
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.28
3ice_A422 Transcription termination factor RHO; transcriptio 95.25
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 95.24
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.2
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.18
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.18
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 95.17
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.17
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.17
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.17
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.11
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.1
3bos_A242 Putative DNA replication factor; P-loop containing 95.07
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.06
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.06
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.04
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 95.03
2ged_A193 SR-beta, signal recognition particle receptor beta 95.03
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.02
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 95.02
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.02
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.02
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.01
3h1t_A590 Type I site-specific restriction-modification syst 94.98
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 94.97
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 94.96
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 94.94
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.94
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 94.92
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 94.91
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 94.9
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 94.87
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 94.85
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 94.85
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 94.85
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 94.81
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.81
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 94.78
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 94.78
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 94.76
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 94.75
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.73
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 94.71
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.71
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 94.7
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 94.69
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 94.68
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 94.68
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 94.65
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 94.65
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 94.63
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 94.63
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 94.62
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.61
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 94.6
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 94.58
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 94.57
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 94.56
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 94.55
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 94.54
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 94.53
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 94.52
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 94.52
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 94.52
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 94.49
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 94.48
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.48
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 94.48
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 94.46
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.46
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.45
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 94.45
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 94.43
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 94.42
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 94.41
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 94.39
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 94.37
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.36
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.36
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 94.35
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.34
3io5_A 333 Recombination and repair protein; storage dimer, i 94.34
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 94.34
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 94.34
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 94.33
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 94.33
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 94.31
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 94.3
3lxw_A247 GTPase IMAP family member 1; immunity, structural 94.3
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 94.28
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 94.28
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 94.26
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 94.26
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 94.24
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.24
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.23
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 94.22
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 94.16
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 94.15
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 94.14
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 94.13
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=99.95  E-value=6.6e-28  Score=252.38  Aligned_cols=224  Identities=53%  Similarity=0.816  Sum_probs=187.0

Q ss_pred             hhHHhhhccchhHHHHHHHHHHhhcCCEEEEeCCCCCCHHHHHHHHHhhcCCCC--CcEEEEcCCcchhhhhHHHHHHHH
Q psy9590         126 LTIVEQRQSLPIYKLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTA--RGKIGCTQPRRVAAMSVAKRVAEE  203 (350)
Q Consensus       126 ~~i~~~r~~lpi~~~~~~i~~~i~~g~v~~liG~nGsGKSTll~~l~~~~~~~~--~G~i~~~~~~~i~~~~~~~~v~~~  203 (350)
                      ..+.+.|..+|++..+..|...+..|+.++++|||||||||+++++++...+..  ++.+.+..|++..+...+.+++..
T Consensus        84 ~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~La~q~~~~l~~~  163 (773)
T 2xau_A           84 VDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEE  163 (773)
T ss_dssp             HHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHHHHHHHHHHHHH
T ss_pred             HHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHHHHHHHHHHHHH
Confidence            345667789999999999999999999999999999999999999987654332  446888899999888888999998


Q ss_pred             hcccccchhhhhhhcccCCCccccccccChhHHHHHHHHhhcCCCCcEEEEcCCCccccccccccChh------------
Q psy9590         204 FGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPT------------  271 (350)
Q Consensus       204 ~~~~~~~~v~~~~~~~~~~~~~~~i~~lS~G~~qr~~ia~all~~~~viIlDEpher~~~~d~ll~~l------------  271 (350)
                      ++...+..+++.+++......+..+..+|.|+++|.+++++++.++++||+||+|+|.+++|.+++++            
T Consensus       164 ~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~~~~~~i  243 (773)
T 2xau_A          164 MDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKI  243 (773)
T ss_dssp             TTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHHCTTCEE
T ss_pred             hCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHHHHHHhCCCceE
Confidence            88888888888777766666678899999999999999999999999999999999999998876554            


Q ss_pred             ----------HHHhhhh----------cCcccceeccCCcc---------------------------------------
Q psy9590         272 ----------KLSKFKK----------NQRLEPLYNKYEEP---------------------------------------  292 (350)
Q Consensus       272 ----------~~~~~~~----------~~~v~~~~~~~~~~---------------------------------------  292 (350)
                                .|.+||+          .+|++.+|......                                       
T Consensus       244 Il~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~~L  323 (773)
T 2xau_A          244 IIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKI  323 (773)
T ss_dssp             EEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHHHHHHHHHHHHHSCSCEEEEECSCHHHHHHHHHHH
T ss_pred             EEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHHHHHHHHHHHHhcCCCCEEEECCCHHHHHHHHHHH
Confidence                      4555665          45555555432211                                       


Q ss_pred             c----------------------------------c-------cceeEEEEEecccccccccCCEEEEEeCCeeeeEeee
Q psy9590         293 N----------------------------------A-------WRISRVVIATNIAETSLTIDGIFYVVDPGFVKQKVYN  331 (350)
Q Consensus       293 ~----------------------------------~-------~~~~~vi~sT~iae~s~ti~d~~~vid~G~~~~~~~~  331 (350)
                      .                                  .       .+.++||+||+++|++++|+++.+|||.|+.+++.||
T Consensus       324 ~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~~~yd  403 (773)
T 2xau_A          324 SLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYN  403 (773)
T ss_dssp             HHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEEEEEE
T ss_pred             HHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCccceeec
Confidence            0                                  0       0136999999999999999999999999999999999


Q ss_pred             cCCCcceeeEeecccCCC
Q psy9590         332 SKTGMDSLVVTPISQDGH  349 (350)
Q Consensus       332 ~~~~~~~l~~~~is~~~a  349 (350)
                      ++.|++.|.+.|+|++++
T Consensus       404 ~~~g~~~L~~~p~S~~s~  421 (773)
T 2xau_A          404 PRIRVESLLVSPISKASA  421 (773)
T ss_dssp             TTTTEEEEEEEECCHHHH
T ss_pred             cccCccccccccCCHHHH
Confidence            999999999999998764
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 350
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-22
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 5e-20
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 2e-16
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 7e-11
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 2e-11
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 9e-04
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 0.001
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 0.001
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 0.002
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 0.002
g1qhh.1 623 c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac 0.003
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

 Score = 94.6 bits (234), Expect = 1e-22
 Identities = 19/128 (14%), Positives = 44/128 (34%), Gaps = 9/128 (7%)

Query: 140 LKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKR 199
           ++ ++ +     ++ I+    G+GKT +    +         +     P RV A  + + 
Sbjct: 1   IEDDIFR---KKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEA 57

Query: 200 VAEEFGCRLGQEVGYTIRFEDCTSSETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHE 259
           +              T       +   ++  M         L  + + NY++I++DEAH 
Sbjct: 58  LRGLPIRY------QTPAIRAEHTGREIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHF 111

Query: 260 RTIHTDVL 267
               +   
Sbjct: 112 TDPASIAA 119
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query350
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.94
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.93
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.93
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.93
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.93
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.93
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.92
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.92
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.92
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.92
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.91
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.9
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.89
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.89
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.88
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.88
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.88
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.88
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.87
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.85
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.7
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.15
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.12
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.02
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.71
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.52
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.48
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.4
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.73
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.56
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.54
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.51
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.35
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.29
d1vmaa2213 GTPase domain of the signal recognition particle r 97.26
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.24
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.19
d2qy9a2211 GTPase domain of the signal recognition particle r 97.16
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 97.11
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.1
d1okkd2207 GTPase domain of the signal recognition particle r 97.07
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.07
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 97.04
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.02
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.0
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 96.99
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 96.99
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 96.97
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.97
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.95
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.89
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.85
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 96.8
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 96.79
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.76
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 96.75
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 96.75
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.75
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.75
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.71
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.68
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.66
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.66
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.65
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.58
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.54
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 96.51
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.5
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.49
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.47
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.46
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.43
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 96.38
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.38
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.34
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.3
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.27
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.25
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.22
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 96.22
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.2
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.2
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 96.17
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.16
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.13
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 96.07
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.03
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.01
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.99
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.98
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.97
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 95.97
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.97
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.95
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.95
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.94
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.93
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.92
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.91
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.88
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 95.87
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.86
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.84
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.84
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.81
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.8
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.79
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.78
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.75
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.74
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.72
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.69
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.68
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.66
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.6
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 95.58
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.58
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.58
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.58
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 95.55
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.53
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.52
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.52
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.51
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.47
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.46
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 95.42
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.38
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.36
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.33
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.32
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.31
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.3
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 95.28
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.28
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.23
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.23
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.2
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.18
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.13
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 95.12
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 95.07
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.06
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.01
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.98
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.97
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.94
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.94
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.93
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.92
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.92
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 94.9
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.87
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.85
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.82
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.79
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.74
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.71
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.7
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.65
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 94.63
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.62
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.59
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.58
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.57
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.55
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.48
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.44
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.43
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.42
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.41
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 94.4
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.4
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.38
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.35
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.35
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.34
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.32
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.31
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.3
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.26
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 94.24
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.23
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.22
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.2
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 94.18
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.16
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 94.14
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.14
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.13
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.12
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.1
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.1
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.07
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.06
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.06
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.05
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.04
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.03
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.0
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.92
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.9
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.88
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 93.85
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.83
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.81
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 93.8
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 93.79
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.79
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.77
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.74
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 93.72
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.7
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.67
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.62
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.61
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 93.58
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 93.55
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.52
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.5
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 93.49
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 93.34
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.34
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 93.32
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 93.31
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 93.17
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.15
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 93.14
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.11
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 93.1
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 93.07
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 93.05
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.05
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.83
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 92.81
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 92.77
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.72
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.65
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.56
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.52
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.45
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 92.43
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 92.43
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.2
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.15
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 91.83
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.43
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.41
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 91.32
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 91.25
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 91.02
d1xpua3289 Transcription termination factor Rho, ATPase domai 90.77
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.52
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 90.46
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 90.13
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 90.13
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 89.9
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.83
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.76
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 89.75
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 89.2
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 89.02
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 89.01
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 88.8
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 88.57
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 88.52
d1tuea_205 Replication protein E1 helicase domain {Human papi 88.17
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 87.81
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 87.78
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 87.39
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 87.3
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 86.94
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 86.59
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 86.42
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 86.28
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 86.23
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 86.21
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 85.35
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 85.24
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 84.98
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 84.95
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 84.74
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 84.51
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 84.31
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 84.06
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 83.59
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 83.24
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 82.67
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 82.48
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 81.92
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.88
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 80.84
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 80.57
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=99.94  E-value=1.4e-28  Score=219.60  Aligned_cols=167  Identities=16%  Similarity=0.240  Sum_probs=118.1

Q ss_pred             HHHHHHHHHhhcCCEEEEeCCCCCCHHHHHHHHHhhcCCCCCcEEEEcCC---------cchhh----------hhHHHH
Q psy9590         139 KLKHELIKAVSDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQP---------RRVAA----------MSVAKR  199 (350)
Q Consensus       139 ~~~~~i~~~i~~g~v~~liG~nGsGKSTll~~l~~~~~~~~~G~i~~~~~---------~~i~~----------~~~~~~  199 (350)
                      .+.+++..++++|++++|+|||||||||++++++|+.. +++|+|.+...         +.+++          +++.++
T Consensus        20 ~al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl~~-p~sG~I~i~g~~i~~~~~~~r~ig~v~Q~~~l~~~ltv~en   98 (239)
T d1v43a3          20 TAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEE-PTEGRIYFGDRDVTYLPPKDRNISMVFQSYAVWPHMTVYEN   98 (239)
T ss_dssp             EEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSC-CSEEEEEETTEECTTSCGGGGTEEEEEC------CCCHHHH
T ss_pred             EEEcceeEEECCCCEEEEECCCCChHHHHHHHHHcCCC-CCCCEEEEcceecccCCcccceEEEEeechhhcccchHHHH
Confidence            34556777899999999999999999999999999984 55898876410         11222          233344


Q ss_pred             HHHHh---ccc---ccchhhhhhhcccCCC-ccccccccChhHHHHHHHHhhcCCCCcEEEEcCCCccccccccccChhH
Q psy9590         200 VAEEF---GCR---LGQEVGYTIRFEDCTS-SETLIKYMTDGMLLRECLVDLDLNNYSVIMLDEAHERTIHTDVLFDPTK  272 (350)
Q Consensus       200 v~~~~---~~~---~~~~v~~~~~~~~~~~-~~~~i~~lS~G~~qr~~ia~all~~~~viIlDEpher~~~~d~ll~~l~  272 (350)
                      ++...   +..   ..+.+...+...+... .++.+..|||||+||++||+||+.+|++||||||               
T Consensus        99 l~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGq~QRvaiAraL~~~P~iLllDEP---------------  163 (239)
T d1v43a3          99 IAFPLKIKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEP---------------  163 (239)
T ss_dssp             HHTTCC--CCCHHHHHHHHHHHHHHTTCGGGTTSCTTTCCSSCHHHHHHHHHHTTCCSEEEEEST---------------
T ss_pred             HHHHHHHcCCCHHHHHHHHHHHHHHcCChhhhcCChhhCCHHHHHHHHHHhhhccCCCceeecCC---------------
Confidence            43211   111   1122333344444433 3477889999999999999999999999999999               


Q ss_pred             HHhhhhcCcccceeccCCcccccce-----eEEEEEecccccccccCCEEEEEeCCeeee
Q psy9590         273 LSKFKKNQRLEPLYNKYEEPNAWRI-----SRVVIATNIAETSLTIDGIFYVVDPGFVKQ  327 (350)
Q Consensus       273 ~~~~~~~~~v~~~~~~~~~~~~~~~-----~~vi~sT~iae~s~ti~d~~~vid~G~~~~  327 (350)
                            +-.+++...........++     .+||++||+++.+..+||+++|++.|++.+
T Consensus       164 ------ts~LD~~~~~~i~~ll~~l~~~~g~tii~vTHd~~~a~~~~dri~vm~~G~iv~  217 (239)
T d1v43a3         164 ------LSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQ  217 (239)
T ss_dssp             ------TTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESCHHHHHHHCSEEEEEETTEEEE
T ss_pred             ------cccCCHHHHHHHHHHHHHHHHhcCCeEEEEeCCHHHHHHhCCEEEEEECCEEEE
Confidence                  5566655444332211111     579999999999999999999999999854
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure