Diaphorina citri psyllid: psy9591

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40

MINQMFMRLMICQKPTRAPRSMMTRTSENIEQLHLDAKQATLKFKDKTISVNRADFSDSLNKLHKYGYDVLSQDWELVAQGEKETPLQKYQRLQCELKELMDEVSQIKEPAENSASDKAKLSVQQIEELVSQVSAIKLDKILGPDLLESLSDVEGAALKTLVMRLDSFALSNSKTPSSKGGVGSGELVRYQLGLQSQQAQLNTAAKLTSLEQRLIKLENLLGEHSSSVRLIKLENLLGEHSSSVCKLFGGGHNSLVENTDWLRAQINLIDAAHCDAYDARITHLSNKLDKIIEKANSVDPKDSERDQRVNELYELSRSVDSALVPRTLERLIALESLHAQAGNFATLLKELESVQVDLASNLTNNQSLLTSLEGKMGSDVERIKQDVKALDEKIKALKK

cHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHcccccccccccccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

****MFM*LMI************************DAKQATLKFKDKTISVNRADFSDSLNKLHKYGYDVLSQDWELVAQG*******KYQRLQCELKE**************************IEELVSQVSAIKLDKILGPDLLESLSDVEGAALKTLVMRLDSFA*****************LVRYQLGL*******NTAAKLTSLEQRLIKLENLLGEHSSSVRLIKLENLLGEHSSSVCKLFGGGHNSLVENTDWLRAQINLIDAAHCDAYDARITHLSNKLDKII********************YELSRSVDSALVPRTLERLIALESLHAQAGNFATLLKELESVQVDLAS********LTS**GK*****ERI*QDVKALDEKIKAL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dynactin subunit 2	Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. Involved in anchoring microtubules to centrosomes. May play a role in synapse formation during brain development.	confident	Q6AYH5
Dynactin subunit 2	Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. Involved in anchoring microtubules to centrosomes. May play a role in synapse formation during brain development.	confident	Q99KJ8
Dynactin subunit 2	Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. Involved in anchoring microtubules to centrosomes. May play a role in synapse formation during brain development.	confident	Q13561

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005737 [CC]	cytoplasm	confident	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005813 [CC]	centrosome	confident	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0031982 [CC]	vesicle	probable	GO:0005575, GO:0043226
GO:0000776 [CC]	kinetochore	probable	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0007052 [BP]	mitotic spindle organization	probable	GO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0005869 [CC]	dynactin complex	probable	GO:0005856, GO:0043234, GO:0015630, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0000086 [BP]	G2/M transition of mitotic cell cycle	probable	GO:0000278, GO:0008150, GO:0009987, GO:0044770, GO:0044772, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0030426 [CC]	growth cone	probable	GO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0040023 [BP]	establishment of nucleus localization	probable	GO:0051234, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0051649, GO:0051647, GO:0051656, GO:0051179, GO:0051640, GO:0051641
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0001754 [BP]	eye photoreceptor cell differentiation	probable	GO:0044707, GO:0030154, GO:0009653, GO:0007275, GO:0044699, GO:0048869, GO:0008150, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0046530, GO:0001654
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045494 [BP]	photoreceptor cell maintenance	probable	GO:0032501, GO:0044707, GO:0043954, GO:0071840, GO:0009987, GO:0007601, GO:0007600, GO:0050953, GO:0044763, GO:0016043, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0010001 [BP]	glial cell differentiation	probable	GO:0032502, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0042063, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0030286 [CC]	dynein complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0007067 [BP]	mitosis	probable	GO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0035088 [BP]	establishment or maintenance of apical/basal cell polarity	probable	GO:0061245, GO:0009987, GO:0007163, GO:0008150, GO:0044763, GO:0044699
GO:0003774 [MF]	motor activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0019886 [BP]	antigen processing and presentation of exogenous peptide antigen via MHC class II	probable	GO:0002504, GO:0019882, GO:0019884, GO:0002478, GO:0002495, GO:0002376, GO:0008150, GO:0048002
GO:0005874 [CC]	microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0060117 [BP]	auditory receptor cell development	probable	GO:0032502, GO:0044707, GO:0030154, GO:0048468, GO:0060119, GO:0060113, GO:0008544, GO:0007275, GO:0044699, GO:0035315, GO:0048869, GO:0048513, GO:0043583, GO:0030855, GO:0002064, GO:0048666, GO:0048699, GO:0009987, GO:0030182, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0048839, GO:0007399, GO:0007423, GO:0009913, GO:0048856, GO:0042491, GO:0042490, GO:0008150
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0030719 [BP]	P granule organization	probable	GO:0022607, GO:0009994, GO:0043933, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0048610, GO:0000578, GO:0009798, GO:0007308, GO:0007309, GO:0035282, GO:0010259, GO:0007275, GO:0071840, GO:0048609, GO:0007389, GO:0071826, GO:0007276, GO:0000003, GO:0009948, GO:0007028, GO:0016043, GO:0022414, GO:0044699, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0008595, GO:0007315, GO:0007314, GO:0044763, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0006996, GO:0044767, GO:0044702, GO:0009952, GO:0044707, GO:0003006, GO:0048856, GO:0044085, GO:0048869, GO:0008150
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FXK, chain A
Confidence level:probable
Coverage over the Query: 350-397
View the alignment between query and template
View the model in PyMOL

Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 200-224
View the alignment between query and template
View the model in PyMOL