Diaphorina citri psyllid: psy9595

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--

GASSSEDFEPSPPAKKKTKAAATGKGAKKKPRTPSKKTKVVKEKAESGVQEEGEVKSTIKTLLPVKQERKHEIMVFRPTYEEFKDFSKFITYMESQGAHKAGLAKVIPPPEWVPRKSGYSLDSSIGDMSIPAPICQVVTGKQGLYQQINIQKRQMTVREYGAMANKPRYATPKHFDYEDLERKYWKNITYVSPIYGADVSGSITDEDVNVWNINHLGTILDYVNEDYGISID

ccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccEEcccHHHHHcHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEECcccccEEEEEEccccccHHHHHHHHccccccccccccHHHHHHHHHHHccccccCCccccccccccccccccccccccHHHHHHccccccccc

********************************************************************RKHEIMVFRPTYEEFKDFSKFITYMESQGAHKAGLAKVIPPPEWVPRKSGYSLDSSIGDMSIPAPICQVVTGKQGLYQQINIQKRQMTVREYGAMANKPRYATPKHFDYEDLERKYWKNITYVSPIYGADVSGSITDEDVNVWNINHLGTILDYVNEDYGI***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable lysine-specific demethylase 4B	Probable histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate.	confident	Q9V6L0
Lysine-specific demethylase 4C	Histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residue, while it has no activity on mono- and dimethylated residues. Demethylation of Lys residue generates formaldehyde and succinate.	confident	Q8VCD7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0035064 [MF]	methylated histone residue binding	probable	GO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0051864 [MF]	histone demethylase activity (H3-K36 specific)	probable	GO:0051213, GO:0003824, GO:0016706, GO:0016705, GO:0032451, GO:0032452, GO:0003674, GO:0016491
GO:0006357 [BP]	regulation of transcription from RNA polymerase II promoter	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0019899 [MF]	enzyme binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0033169 [BP]	histone H3-K9 demethylation	probable	GO:0008214, GO:0044699, GO:0044267, GO:0006482, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016577, GO:0016570, GO:0006996, GO:0009987, GO:0044710, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0070988, GO:0044238, GO:0051276, GO:0070076, GO:0019538, GO:0044237, GO:0043170, GO:0044763, GO:0016568, GO:0016569
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0070544 [BP]	histone H3-K36 demethylation	probable	GO:0008214, GO:0044699, GO:0044267, GO:0006482, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016577, GO:0016570, GO:0006996, GO:0009987, GO:0044710, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0070988, GO:0044238, GO:0051276, GO:0070076, GO:0019538, GO:0044237, GO:0043170, GO:0044763, GO:0016568, GO:0016569
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0032454 [MF]	histone demethylase activity (H3-K9 specific)	probable	GO:0032451, GO:0032452, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DXT, chain A
Confidence level:very confident
Coverage over the Query: 66-232
View the alignment between query and template
View the model in PyMOL