Diaphorina citri psyllid: psy959

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MVSTDKDLLKTHRSLLLQAIPGRRHFMPPIRLRTLYYTDWGRFGTAGKILRTTMAGSLKKVIIEKDLSQPSGLAIDFDDEMLYWTDAVREKIERSDLAGNNREALYLNK
cccccccccccccEEEccccccccEEEECcccccEEEEEcccccccccEEEEEccccccEEEEEcccccccEEEEEccccCEEEEEccccEEEEEccccccEEEEEccc
*VS*D**LLKTHRSLLLQAIPGRRHFMPPIRLRTLYYTDWGRFGTAGKILRTTMAGSLKKVIIEKDLSQPSGLAIDFDDEMLYWTDAVREKIERSDLAGNNREALY***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSTDKDLLKTHRSLLLQAIPGRRHFMPPIRLRTLYYTDWGRFGTAGKILRTTMAGSLKKVIIEKDLSQPSGLAIDFDDEMLYWTDAVREKIERSDLAGNNREALYLNK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0045859 [BP]regulation of protein kinase activityprobableGO:0042325, GO:0032268, GO:0019220, GO:0019222, GO:0050790, GO:0060255, GO:0051246, GO:0043549, GO:0031323, GO:0051338, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0065009, GO:0001932, GO:0050789, GO:0080090
GO:0030111 [BP]regulation of Wnt receptor signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0030100 [BP]regulation of endocytosisprobableGO:0051049, GO:0051128, GO:0060627, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0050794
GO:0005041 [MF]low-density lipoprotein receptor activityprobableGO:0038024, GO:0003674, GO:0030228, GO:0004872
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0044093 [BP]positive regulation of molecular functionprobableGO:0008150, GO:0065009, GO:0065007
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0048082 [BP]regulation of adult chitin-containing cuticle pigmentationprobableGO:0048079, GO:0007564, GO:0048070, GO:0008150, GO:0050793, GO:2000026, GO:0051239, GO:0065007, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0040003 [BP]chitin-based cuticle developmentprobableGO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0038023 [MF]signaling receptor activityprobableGO:0060089, GO:0003674, GO:0004872, GO:0004871

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S94, chain A
Confidence level:very confident
Coverage over the Query: 3-108
View the alignment between query and template
View the model in PyMOL