Diaphorina citri psyllid: psy9620


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450---
TYKSSSSGGSSRGTSRYGTSGGGGYGGSSRSGGYGGGYGGGSGGGRFGDRGGRGKNSTMGGALRAIDWGNLPPFEKNFFHPSPSVLNRSPHEVQAFRDKHQMTLKGNAPNPITEFAEANFPDYVLKEVKRQGFDRPTPIQAQGWPIAMSGSNMVGVAQTGSGKTLAYMLPAIVHINHQSQLKPGDGPIVLVLAPTRELAQQIQEVARDFGSSTYLRSTCVYGGASKGPQPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKEFRNGRAGILVATDVAARGLDVDDVKFVINFDYPNNSEDYIHRIGRTGRSDNTGTSYTFFTQQNSRQAKDLIDVLTESNHPVDPKLSALASRSGGSGGGYQVLHYSLKT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHccccccccccccHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHccccccCEEEEEccccccccccCEEEEECcccHHHHHHHHHHHHccccEEEEEcccccccccEEEEEEEcccHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHcccccEEEEEHHcccccccccccEEEEcccccccccccccccccccccccCEEEEEEccccHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccc
**************************************************************LRAIDWGNLPPFEKNFFHPSPSVLNRSPHEVQAFRDKHQMTLKGNAPNPITEFAEANFPDYVLKEVKRQGFDRPTPIQAQGWPIAMSGSNMVGVAQTGSGKTLAYMLPAIVHINHQSQLKPGDGPIVLVLAPTRELAQQIQEVARDFGSSTYLRSTCVYGGASKGPQPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKEFRNGRAGILVATDVAARGLDVDDVKFVINFDYPNNSEDYIHRIGRTGRSDNTGTSYTFFTQQNSRQAKDLIDVLTESNHPVDPKL***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TYKSSSSGGSSRGTSRYGTSGGGGYGGSSRSGGYGGGYGGGSGGGRFGDRGGRGKNSTMGGALRAIDWGNLPPFEKNFFHPSPSVLNRSPHEVQAFRDKHQMTLKGNAPNPITEFAEANFPDYVLKEVKRQGFDRPTPIQAQGWPIAMSGSNMVGVAQTGSGKTLAYMLPAIVHINHQSQLKPGDGPIVLVLAPTRELAQQIQEVARDFGSSTYLRSTCVYGGASKGPQPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKEFRNGRAGILVATDVAARGLDVDDVKFVINFDYPNNSEDYIHRIGRTGRSDNTGTSYTFFTQQNSRQAKDLIDVLTESNHPVDPKLSALASRSGGSGGGYQVLHYSLKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ATP-dependent RNA helicase DDX5 Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specicic manner; the function probbaly involves association with histone deacetylases, such as HDAC1.confidentQ5R4I9
Probable ATP-dependent RNA helicase DDX5 Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specicic manner; the function probbaly involves association with histone deacetylases, such as HDAC1.confidentQ61656
ATP-dependent RNA helicase DBP2 ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing.confidentQ6C4D4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0016070 [BP]RNA metabolic processprobableGO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0043186 [CC]P granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0033148 [BP]positive regulation of intracellular estrogen receptor signaling pathwayprobableGO:0033145, GO:0033146, GO:0033143, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048306 [MF]calcium-dependent protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:2001014 [BP]regulation of skeletal muscle cell differentiationprobableGO:1901861, GO:0016202, GO:0051239, GO:0050793, GO:0048634, GO:0050794, GO:0008150, GO:0051153, GO:0045595, GO:0065007, GO:2000026, GO:0051147, GO:0048641, GO:0050789
GO:0004004 [MF]ATP-dependent RNA helicase activityprobableGO:0016787, GO:0016818, GO:0008026, GO:0042623, GO:0003824, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003724, GO:0003674, GO:0016887, GO:0008186, GO:0016462
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0034655 [BP]nucleobase-containing compound catabolic processprobableGO:0006139, GO:1901575, GO:0044270, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0046700, GO:0044248, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0019439, GO:0046483, GO:0009056, GO:1901360, GO:1901361
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030331 [MF]estrogen receptor bindingprobableGO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0050681 [MF]androgen receptor bindingprobableGO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0036002 [MF]pre-mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005703 [CC]polytene chromosome puffprobableGO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0000381 [BP]regulation of alternative mRNA splicing, via spliceosomeprobableGO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0048024, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.13RNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FE2, chain A
Confidence level:very confident
Coverage over the Query: 91-263
View the alignment between query and template
View the model in PyMOL
Template: 2I4I, chain A
Confidence level:very confident
Coverage over the Query: 103-437
View the alignment between query and template
View the model in PyMOL