Diaphorina citri psyllid: psy9623

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----

MSSLSLPRVLQPRKTSLELERETFEKFQSASIGKAVNSQETPVKEKHFHLKDGYGKLIYQYTRLLLGKLDFHRRNPGFPGNLILSQSELDRIGENDINNYFQMSVEMFDYLDEILALQAAVFGSLDMSRSNSMTSSGQCRLSPLIPCIQDSSQLYDFCVKILFKLHASLPSEILAGHRSRFLKQFSQLRQFYMTSSTLQYFKHLIQVPTLPETPPNLLIQAELGSYVTPVVILPDPPSTSDPGDSMSPVTGDLVDISHTSSQNASNAILGTFHDKSSTIFWQCASRLPLMENVIVAWKFCHVLHKILREGHPHVIKESIKQAQVITNVGKMWHAAQYISRSCRRVRFRAAQKTRR

cccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccc

*SSLSLPRVLQPRKTSLELERETFEKFQSAS**************KHFHLKDGYGKLIYQYTRLLLGKLDFHRRNPGFPGNLILSQSELDRIGENDINNYFQMSVEMFDYLDEILALQAAVFGSLDM******T**GQCRLSPLIPCIQDSSQLYDFCVKILFKLHASLPSEILAGHRSRFLKQFSQLRQFYMTSSTLQYFKHLIQVPTLPETPPNLLIQAELGSYVTPVVIL**************************S******AILGTFHDKSSTIFWQCASRLPLMENVIVAWKFCHVLHKILREGHPHVIKESIKQAQVITNVGKMWHAAQYISRSCRRVRF********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030479 [CC]	actin cortical patch	probable	GO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0030864, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0006897 [BP]	endocytosis	probable	GO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0035091 [MF]	phosphatidylinositol binding	probable	GO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0030136 [CC]	clathrin-coated vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0031982

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HX8, chain A
Confidence level:very confident
Coverage over the Query: 53-229
View the alignment between query and template
View the model in PyMOL

Template: 3ZYM, chain A
Confidence level:confident
Coverage over the Query: 27-81,95-198
View the alignment between query and template
View the model in PyMOL

Template: 3ZYM, chain A
Confidence level:confident
Coverage over the Query: 254-353
View the alignment between query and template
View the model in PyMOL