Diaphorina citri psyllid: psy9625


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MLTQSRRADTGVKLEVNEKILDSCTTLMKAIRILVQKSPDDLDIASLSLHQARRLEMEAQAEIIMAHHGSASNTREFYKRNHQWTEGLISAAKAVAMSAKYLLTAADQVVSGGEGAKLERLIVASHGVAASTAQLVVASRVKAERNSVHLAALSQASRDVTNATGSVVATAKTCIHLAEIIMAHHGSASNTREFYKRNHQWTEGLISAAKAVAMSAKYLLTAADQVVSGGEGAKLERLIVASHGVAASTAQLVVASRVKAERNSVHLAALSQASRDVTNATGSVVATAKTCIHLVDESADDLDIASLSLHQARRLEMEAQVRVLELEAGLEKERLKLSALRRHHLLKKKIVYLALFQEIRDAPKLRAILTVEVSVVFGRHRQFPTHNTLPDRPF
ccccccccccccccHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHEEEEEccccccccccccccccc
************KLEVNEKILDSCTTLMKAIRILVQKSPDDLDIASLSLHQARRLEMEAQAEIIMAHHGSASNTREFYKRNHQWTEGLISAAKAVAMSAKYLLTAADQVVSGGEGAKLERLIVASHGVAASTAQLVVASRVKAERNSVHLAALSQASRDVTNATGSVVATAKTCIHLAEIIMAHHGSASNTREFYKRNHQWTEGLISAAKAVAMSAKYLLTAADQVVSGGEGAKLERLIVASHGVAASTAQLVVASRVKAERNSVHLAALSQASRDVTNATGSVVATAKTCIHLVDESADDLDIASLSLHQARRLEMEAQVRVLELEAGLEKERLKLSALRRHHLLKKKIVYLALFQEIRDAPKLRAILTVEVSVVFGRHRQFP**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTQSRRADTGVKLEVNEKILDSCTTLMKAIRILVQKSPDDLDIASLSLHQARRLEMEAQAEIIMAHHGSASNTREFYKRNHQWTEGLISAAKAVAMSAKYLLTAADQVVSGGEGAKLERLIVASHGVAASTAQLVVASRVKAERNSVHLAALSQASRDVTNATGSVVATAKTCIHLAEIIMAHHGSASNTREFYKRNHQWTEGLISAAKAVAMSAKYLLTAADQVVSGGEGAKLERLIVASHGVAASTAQLVVASRVKAERNSVHLAALSQASRDVTNATGSVVATAKTCIHLVDESADDLDIASLSLHQARRLEMEAQVRVLELEAGLEKERLKLSALRRHHLLKKKIVYLALFQEIRDAPKLRAILTVEVSVVFGRHRQFPTHNTLPDRPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Huntington interacting protein related 1 confidentQ02328
Huntingtin-interacting protein 1 Plays a role in clathrin-mediated endocytosis and trafficking. Involved in regulating AMPA receptor trafficking in the central nervous system in an NMDA-dependent manner. Enhances androgen receptor (AR)-mediated transcription. May act as a proapoptotic protein that induces cell death by acting through the intrinsic apoptosis pathway. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis. May play a functional role in the cell filament networks. May be required for differentiation, proliferation, and/or survival of somatic and germline progenitors.confidentO00291
Huntingtin-interacting protein 1 Plays a role in clathrin-mediated endocytosis and trafficking. Involved in regulating AMPA receptor trafficking in the central nervous system in an NMDA-dependent manner. Enhances androgen receptor (AR)-mediated transcription. May act as a proapoptotic protein that induces cell death by acting through the intrinsic apoptosis pathway. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis. May play a functional role in the cell filament networks. May be required for differentiation, proliferation, and/or survival of somatic and germline progenitors.confidentQ8VD75

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048268 [BP]clathrin coat assemblyprobableGO:0022607, GO:0070271, GO:0043933, GO:0006901, GO:0006900, GO:0061024, GO:0034622, GO:0044699, GO:0071822, GO:0016044, GO:0016043, GO:0065003, GO:0071840, GO:0006461, GO:0006810, GO:0044765, GO:0044763, GO:0051234, GO:0043623, GO:0051179, GO:0006996, GO:0016192, GO:0016050, GO:0044085, GO:0008150, GO:0009987
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0035091 [MF]phosphatidylinositol bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0030479 [CC]actin cortical patchprobableGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0030864, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0030276 [MF]clathrin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006919 [BP]activation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0097202, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0043280, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030136 [CC]clathrin-coated vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0031982

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R0D, chain A
Confidence level:very confident
Coverage over the Query: 3-40,59-175
View the alignment between query and template
View the model in PyMOL
Template: 1R0D, chain A
Confidence level:very confident
Coverage over the Query: 115-301
View the alignment between query and template
View the model in PyMOL
Template: 1SJ8, chain A
Confidence level:very confident
Coverage over the Query: 18-175
View the alignment between query and template
View the model in PyMOL
Template: 3FYQ, chain A
Confidence level:confident
Coverage over the Query: 201-342
View the alignment between query and template
View the model in PyMOL