Diaphorina citri psyllid: psy962

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----

MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEGNHGFHIHEFGDNTNGCTSAGPHFNPLGKDHGAPSDADRHVGDLGNIVATANKVAKVEIEDSIISLTGANNIVGRTLVVHADPDDLGKGGHELSKTTGNAGARIACGVIGIAKA

cccEEEEEECccccCEEEEEEEEEcccccEEEEEEEEccccccCEEEEEccccccccccccccccccccccccccccccccccccccEEEcccEEEEEEEEEccEEEccccccccEEEEEccccccccccccccccccccccccEEEEEEEEEEc

*PAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEGNHGFHIHEFGDNTNGCTSAGPHFNPLGKDHGAPSDADRHVGDLGNIVATANKVAKVEIEDSIISLTGANNIVGRTLVVHADPDDLGKGGHELSKTTGNAGARIACGVIGIAK*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEGNHGFHIHEFGDNTNGCTSAGPHFNPLGKDHGAPSDADRHVGDLGNIVATANKVAKVEIEDSIISLTGANNIVGRTLVVHADPDDLGKGGHELSKTTGNAGARIACGVIGIAKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Superoxide dismutase [Cu-Zn]	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.	very confident	P80566
Superoxide dismutase [Cu-Zn]	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.	very confident	P08228
Superoxide dismutase [Cu-Zn]	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.	very confident	P60052

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000303 [BP]	response to superoxide	confident	GO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0042554 [BP]	superoxide anion generation	confident	GO:0072593, GO:0009987, GO:0044237, GO:0008150, GO:0006801, GO:0008152
GO:0043025 [CC]	neuronal cell body	confident	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0009410 [BP]	response to xenobiotic stimulus	confident	GO:0042221, GO:0050896, GO:0008150
GO:0005507 [MF]	copper ion binding	confident	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005615 [CC]	extracellular space	confident	GO:0005575, GO:0005576, GO:0044421
GO:0007275 [BP]	multicellular organismal development	confident	GO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0048856 [BP]	anatomical structure development	confident	GO:0032502, GO:0008150
GO:0045541 [BP]	negative regulation of cholesterol biosynthetic process	confident	GO:0051055, GO:0009892, GO:0080090, GO:0009890, GO:0019216, GO:0045939, GO:0019218, GO:0008150, GO:0090206, GO:0009889, GO:0090181, GO:0065007, GO:0045833, GO:0010894, GO:0048519, GO:0046890, GO:0050810, GO:0019222, GO:0045540, GO:0050789
GO:0010038 [BP]	response to metal ion	confident	GO:0042221, GO:0050896, GO:0010035, GO:0008150
GO:0043234 [CC]	protein complex	confident	GO:0005575, GO:0032991
GO:0005829 [CC]	cytosol	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031667 [BP]	response to nutrient levels	confident	GO:0009991, GO:0008150, GO:0050896, GO:0009605
GO:0048609 [BP]	multicellular organismal reproductive process	confident	GO:0022414, GO:0032501, GO:0008150, GO:0000003, GO:0032504
GO:0005773 [CC]	vacuole	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003006 [BP]	developmental process involved in reproduction	confident	GO:0032502, GO:0022414, GO:0008150, GO:0000003
GO:0004784 [MF]	superoxide dismutase activity	confident	GO:0016721, GO:0016209, GO:0003674, GO:0003824, GO:0016491
GO:0001306 [BP]	age-dependent response to oxidative stress	confident	GO:0032502, GO:0007571, GO:0007568, GO:0050896, GO:0044767, GO:0006950, GO:0008150, GO:0006979, GO:0044699
GO:0044706 [BP]	multi-multicellular organism process	confident	GO:0032501, GO:0008150, GO:0051704
GO:0051770 [BP]	positive regulation of nitric-oxide synthase biosynthetic process	confident	GO:0009893, GO:0019222, GO:0009891, GO:0060255, GO:0009889, GO:0008150, GO:0010557, GO:0010556, GO:0051769, GO:0048518, GO:0065007, GO:0050789, GO:0010604
GO:0005886 [CC]	plasma membrane	confident	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0031012 [CC]	extracellular matrix	confident	GO:0005575
GO:0060047 [BP]	heart contraction	confident	GO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0003015, GO:0044699, GO:0003008
GO:0005730 [CC]	nucleolus	confident	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]	protein homodimerization activity	confident	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0001819 [BP]	positive regulation of cytokine production	confident	GO:0051240, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789
GO:0034614 [BP]	cellular response to reactive oxygen species	confident	GO:1901700, GO:1901701, GO:0051716, GO:0070887, GO:0050896, GO:0009987, GO:0000302, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0034599, GO:0006979, GO:0044699
GO:0051597 [BP]	response to methylmercury	confident	GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0030346 [MF]	protein phosphatase 2B binding	confident	GO:0019899, GO:0019903, GO:0019902, GO:0003674, GO:0005488, GO:0005515
GO:0008270 [MF]	zinc ion binding	confident	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0044419 [BP]	interspecies interaction between organisms	confident	GO:0008150, GO:0051704
GO:0032839 [CC]	dendrite cytoplasm	confident	GO:0005737, GO:0032838, GO:0044463, GO:0044464, GO:0030425, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0005623, GO:0043005, GO:0044424, GO:0042995
GO:0016043 [BP]	cellular component organization	confident	GO:0008150, GO:0071840
GO:0009628 [BP]	response to abiotic stimulus	confident	GO:0050896, GO:0008150
GO:0030003 [BP]	cellular cation homeostasis	confident	GO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0007569 [BP]	cell aging	confident	GO:0032502, GO:0007568, GO:0009987, GO:0044767, GO:0044763, GO:0008150, GO:0044699
GO:0000187 [BP]	activation of MAPK activity	confident	GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0045335 [CC]	phagocytic vesicle	confident	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0006302 [BP]	double-strand break repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0006309 [BP]	apoptotic DNA fragmentation	probable	GO:0006921, GO:0097194, GO:0090304, GO:0090305, GO:0034641, GO:0030262, GO:0007569, GO:0044699, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071840, GO:0016043, GO:0006308, GO:0008150, GO:0071704, GO:1901360, GO:0010259, GO:0009987, GO:0044238, GO:0006915, GO:0006725, GO:0046700, GO:0006259, GO:0044763, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0044270, GO:0012501, GO:0000737, GO:0044237, GO:0043170, GO:0006807, GO:0019439, GO:0022411
GO:0007281 [BP]	germ cell development	probable	GO:0032502, GO:0044702, GO:0048609, GO:0032504, GO:0022414, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0019953, GO:0044767, GO:0003006, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0009987, GO:0000003, GO:0007276, GO:0048856
GO:0007283 [BP]	spermatogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0006882 [BP]	cellular zinc ion homeostasis	probable	GO:0019725, GO:0072507, GO:0065008, GO:0072503, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0030003, GO:0055080, GO:0008150, GO:0055082, GO:0055069, GO:0044699
GO:0007626 [BP]	locomotory behavior	probable	GO:0044708, GO:0050896, GO:0008150, GO:0007610
GO:0001975 [BP]	response to amphetamine	probable	GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0014075, GO:1901698
GO:0060052 [BP]	neurofilament cytoskeleton organization	probable	GO:0006996, GO:0007010, GO:0045104, GO:0009987, GO:0016043, GO:0045103, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0005777 [CC]	peroxisome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006879 [BP]	cellular iron ion homeostasis	probable	GO:0019725, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0055072, GO:0044763, GO:0008150, GO:0030003, GO:0055065, GO:0055080, GO:0065007, GO:0055082, GO:0065008, GO:0044699
GO:0006878 [BP]	cellular copper ion homeostasis	probable	GO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0055070, GO:0065007, GO:0044763, GO:0030003, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0032287 [BP]	peripheral nervous system myelin maintenance	probable	GO:0042391, GO:0019226, GO:0044707, GO:0021782, GO:0050801, GO:0030154, GO:0048468, GO:0022011, GO:0061024, GO:0007009, GO:0023052, GO:0010001, GO:0001508, GO:0007272, GO:0007275, GO:0044699, GO:0042552, GO:0014037, GO:0016044, GO:0016043, GO:0008150, GO:0042592, GO:0065007, GO:0071840, GO:0050877, GO:0019725, GO:0065008, GO:0032502, GO:0032501, GO:0032292, GO:0019228, GO:0009987, GO:0042063, GO:0006873, GO:0044767, GO:0014044, GO:0044763, GO:0008366, GO:0007154, GO:0022008, GO:0003008, GO:0044700, GO:0043217, GO:0007399, GO:0007422, GO:0048856, GO:0048878, GO:0035637, GO:0048869, GO:0055082, GO:0048731
GO:0008217 [BP]	regulation of blood pressure	probable	GO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0065007, GO:0065008, GO:0044699, GO:0003008
GO:0050665 [BP]	hydrogen peroxide biosynthetic process	probable	GO:0009987, GO:0044237, GO:0044249, GO:0009058, GO:0042743, GO:0072593, GO:0008152, GO:0008150
GO:0040014 [BP]	regulation of multicellular organism growth	probable	GO:0008150, GO:0040008, GO:0065007, GO:0050789, GO:0051239
GO:0035195 [BP]	gene silencing by miRNA	probable	GO:0010605, GO:0019222, GO:0035194, GO:0010608, GO:0009987, GO:0040029, GO:0050789, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0044763, GO:0031047, GO:0010629, GO:0048519, GO:0016441, GO:0009892, GO:0010468, GO:0044699
GO:0048678 [BP]	response to axon injury	probable	GO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0043524 [BP]	negative regulation of neuron apoptotic process	probable	GO:0010941, GO:0060548, GO:0043066, GO:0050794, GO:0008150, GO:0043067, GO:0043523, GO:0065007, GO:0048523, GO:0048519, GO:1901214, GO:1901215, GO:0042981, GO:0050789, GO:0043069
GO:0002262 [BP]	myeloid cell homeostasis	probable	GO:0042592, GO:0048872, GO:0002376, GO:0065007, GO:0008150, GO:0065008
GO:0071688 [BP]	striated muscle myosin thick filament assembly	probable	GO:0031034, GO:0031033, GO:0031032, GO:0070271, GO:0043933, GO:0051146, GO:0048468, GO:0030036, GO:0010927, GO:0022607, GO:0034622, GO:0061061, GO:0009653, GO:0044699, GO:0071822, GO:0048869, GO:0016043, GO:0032989, GO:0065003, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030154, GO:0030029, GO:0030239, GO:0006461, GO:0044767, GO:0008150, GO:0070925, GO:0043623, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0044763, GO:0009987, GO:0042692
GO:0071280 [BP]	cellular response to copper ion	probable	GO:0051716, GO:0071248, GO:0010038, GO:0046688, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010035, GO:0044699
GO:0010039 [BP]	response to iron ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0031505 [BP]	fungal-type cell wall organization	probable	GO:0008150, GO:0009987, GO:0016043, GO:0071554, GO:0071555, GO:0044763, GO:0044699, GO:0045229, GO:0071840, GO:0071852
GO:0046716 [BP]	muscle cell homeostasis	probable	GO:0019725, GO:0060249, GO:0009987, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0065008, GO:0044699
GO:0009579 [CC]	thylakoid	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009570 [CC]	chloroplast stroma	probable	GO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0008089 [BP]	anterograde axon cargo transport	probable	GO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0008088, GO:0030705, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0006928, GO:0051179, GO:0044699, GO:0051641
GO:0060378 [BP]	regulation of brood size	probable	GO:0032501, GO:0048609, GO:0032504, GO:0044706, GO:0022414, GO:0065007, GO:0008150, GO:0065008, GO:0000003, GO:0051704
GO:0042542 [BP]	response to hydrogen peroxide	probable	GO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0070050 [BP]	neuron homeostasis	probable	GO:0019725, GO:0060249, GO:0009987, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0065008, GO:0044699
GO:0071486 [BP]	cellular response to high light intensity	probable	GO:0009628, GO:0071484, GO:0071478, GO:0071482, GO:0009314, GO:0050896, GO:0009987, GO:0051716, GO:0008150, GO:0009416, GO:0071214, GO:0044763, GO:0009644, GO:0009642, GO:0044699
GO:0071472 [BP]	cellular response to salt stress	probable	GO:0009628, GO:0051716, GO:0009987, GO:0050896, GO:0071470, GO:0044763, GO:0008150, GO:0006950, GO:0006970, GO:0033554, GO:0009651, GO:0071214, GO:0044699
GO:0006749 [BP]	glutathione metabolic process	probable	GO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006575, GO:0043603, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0006518, GO:0044281
GO:0009408 [BP]	response to heat	probable	GO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0042493 [BP]	response to drug	probable	GO:0042221, GO:0050896, GO:0008150
GO:0048046 [CC]	apoplast	probable	GO:0005575, GO:0005576
GO:0010106 [BP]	cellular response to iron ion starvation	probable	GO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0043581 [BP]	mycelium development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0051881 [BP]	regulation of mitochondrial membrane potential	probable	GO:0019725, GO:0042391, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0060088 [BP]	auditory receptor cell stereocilium organization	probable	GO:0048666, GO:0048562, GO:0030030, GO:0048568, GO:0030154, GO:0048468, GO:0009790, GO:0060119, GO:0008544, GO:0060113, GO:0009653, GO:0060117, GO:0044699, GO:0035315, GO:0000904, GO:0000902, GO:0048869, GO:0071840, GO:0016043, GO:0007275, GO:0008150, GO:0048513, GO:0043583, GO:0030855, GO:0002064, GO:0048598, GO:0048667, GO:0009887, GO:0060429, GO:0030182, GO:0032501, GO:0009987, GO:0048699, GO:0009888, GO:0044767, GO:0060122, GO:0044763, GO:0048731, GO:0022008, GO:0042471, GO:0048839, GO:0042472, GO:0007423, GO:0044707, GO:0009913, GO:0048856, GO:0007399, GO:0042491, GO:0042490, GO:0032502, GO:0032989, GO:0002093
GO:0045454 [BP]	cell redox homeostasis	probable	GO:0019725, GO:0009987, GO:0050794, GO:0042592, GO:0044763, GO:0008150, GO:0065007, GO:0065008, GO:0050789, GO:0044699
GO:0060087 [BP]	relaxation of vascular smooth muscle	probable	GO:0006940, GO:0003012, GO:0003013, GO:0003018, GO:0042311, GO:0045986, GO:0044557, GO:0050789, GO:0044699, GO:0050880, GO:0044057, GO:0051241, GO:0090066, GO:0065007, GO:0048519, GO:0065008, GO:0035150, GO:0045932, GO:0006937, GO:0008015, GO:0032501, GO:0008150, GO:0090257, GO:0051239, GO:0003008, GO:0044707, GO:0090075
GO:0040027 [BP]	negative regulation of vulval development	probable	GO:0051093, GO:0050793, GO:0051241, GO:0040028, GO:0048581, GO:0048580, GO:0050789, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0061062, GO:0061064
GO:0007605 [BP]	sensory perception of sound	probable	GO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0071329 [BP]	cellular response to sucrose stimulus	probable	GO:1901700, GO:1901701, GO:0009744, GO:0009743, GO:0034285, GO:0071322, GO:0050896, GO:0009987, GO:0051716, GO:0071324, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0001541 [BP]	ovarian follicle development	probable	GO:0022602, GO:0061458, GO:0008585, GO:0048608, GO:0007275, GO:0044699, GO:0000003, GO:0008406, GO:0045137, GO:0048511, GO:0048513, GO:0032502, GO:0032501, GO:0046545, GO:0048609, GO:0032504, GO:0044767, GO:0022414, GO:0008150, GO:0046660, GO:0007548, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0042698, GO:0048731
GO:0008090 [BP]	retrograde axon cargo transport	probable	GO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0008088, GO:0030705, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0006928, GO:0051179, GO:0044699, GO:0051641
GO:0001320 [BP]	age-dependent response to reactive oxygen species involved in chronological cell aging	probable	GO:0000302, GO:0070887, GO:0072353, GO:0044699, GO:0001315, GO:0007571, GO:0032502, GO:1901700, GO:0009987, GO:0034614, GO:0051716, GO:0044767, GO:0006950, GO:0044763, GO:0042221, GO:0034599, GO:0001323, GO:0001324, GO:0006979, GO:0001306, GO:1901701, GO:0007568, GO:0007569, GO:0001300, GO:0050896, GO:0033554, GO:0008150
GO:0031152 [BP]	aggregation involved in sorocarp development	probable	GO:0030582, GO:0030587, GO:0061458, GO:0019954, GO:0009991, GO:0075259, GO:0042594, GO:0007275, GO:0044699, GO:0000003, GO:0048513, GO:0032502, GO:0032501, GO:0048608, GO:0044767, GO:0022414, GO:0006950, GO:0008150, GO:0055084, GO:0044707, GO:0009605, GO:0003006, GO:0050896, GO:0048856, GO:0031667, GO:0048731
GO:0051087 [MF]	chaperone binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0002576 [BP]	platelet degranulation	probable	GO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005758 [CC]	mitochondrial intermembrane space	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0030168 [BP]	platelet activation	probable	GO:0009987, GO:0007599, GO:0050878, GO:0044707, GO:0006950, GO:0032501, GO:0007596, GO:0009611, GO:0042060, GO:0065007, GO:0001775, GO:0050817, GO:0044763, GO:0008150, GO:0065008, GO:0050896, GO:0044699
GO:0018991 [BP]	oviposition	probable	GO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0019430 [BP]	removal of superoxide radicals	probable	GO:0000303, GO:0000302, GO:0006801, GO:0070887, GO:0044699, GO:0051716, GO:0071451, GO:0009987, GO:0034614, GO:0072593, GO:0006950, GO:0044763, GO:0008152, GO:0042221, GO:0034599, GO:0010035, GO:0006979, GO:1901700, GO:1901701, GO:0050896, GO:0044237, GO:0033554, GO:0008150
GO:0042742 [BP]	defense response to bacterium	probable	GO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0071457 [BP]	cellular response to ozone	probable	GO:1901700, GO:1901701, GO:0051716, GO:0033554, GO:0050896, GO:0009987, GO:0034614, GO:0006950, GO:0000302, GO:0008150, GO:0070887, GO:0044763, GO:0010193, GO:0042221, GO:0034599, GO:0010035, GO:0006979, GO:0044699
GO:0045471 [BP]	response to ethanol	probable	GO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033
GO:0001895 [BP]	retina homeostasis	probable	GO:0032501, GO:0048871, GO:0044707, GO:0060249, GO:0042592, GO:0008150, GO:0065007, GO:0001894, GO:0065008, GO:0044699
GO:0051091 [BP]	positive regulation of sequence-specific DNA binding transcription factor activity	probable	GO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0007566 [BP]	embryo implantation	probable	GO:0032502, GO:0044703, GO:0044702, GO:0000003, GO:0044707, GO:0044706, GO:0007565, GO:0022414, GO:0032501, GO:0008150, GO:0007275, GO:0044699, GO:0051704
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0071493 [BP]	cellular response to UV-B	probable	GO:0009628, GO:0051716, GO:0071478, GO:0071482, GO:0009314, GO:0050896, GO:0009987, GO:0008150, GO:0009411, GO:0009416, GO:0071214, GO:0034644, GO:0044763, GO:0010224, GO:0044699
GO:0044351 [BP]	macropinocytosis	probable	GO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0004842 [MF]	ubiquitin-protein ligase activity	probable	GO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0006096 [BP]	glycolysis	probable	GO:0071704, GO:0019320, GO:1901575, GO:0005975, GO:0044238, GO:0046365, GO:0005996, GO:0009987, GO:0019318, GO:0044237, GO:0016052, GO:0008150, GO:0008152, GO:0044723, GO:0006091, GO:0006007, GO:0009056, GO:0006006, GO:0044724
GO:0006094 [BP]	gluconeogenesis	probable	GO:1901576, GO:0005975, GO:0044238, GO:0005996, GO:0019318, GO:0019319, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0046364, GO:0044723, GO:0006006
GO:0043065 [BP]	positive regulation of apoptotic process	probable	GO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0046686 [BP]	response to cadmium ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0033081 [BP]	regulation of T cell differentiation in thymus	probable	GO:0051249, GO:0008150, GO:0050865, GO:0050793, GO:0045595, GO:0050863, GO:0050794, GO:0045580, GO:0002694, GO:1902105, GO:0065007, GO:0002682, GO:0045619, GO:0051239, GO:2000026, GO:0050789
GO:0030288 [CC]	outer membrane-bounded periplasmic space	probable	GO:0005623, GO:0044462, GO:0044464, GO:0030313, GO:0031975, GO:0005575, GO:0071944, GO:0042597, GO:0030312
GO:0000209 [BP]	protein polyubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0046620 [BP]	regulation of organ growth	probable	GO:0008150, GO:0040008, GO:0065007, GO:0050789, GO:0051239
GO:0043161 [BP]	proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0009650 [BP]	UV protection	probable	GO:0009628, GO:0009314, GO:0050896, GO:0009411, GO:0008150, GO:0009416
GO:0030446 [CC]	hyphal cell wall	probable	GO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0001890 [BP]	placenta development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048538 [BP]	thymus development	probable	GO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0005759 [CC]	mitochondrial matrix	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.15.-.-	Acting on superoxide as acceptor.	probable
1.15.1.-	Acting on superoxide as acceptor.	probable
1.15.1.1	Superoxide dismutase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L9Y, chain A
Confidence level:very confident
Coverage over the Query: 3-155
View the alignment between query and template
View the model in PyMOL