Diaphorina citri psyllid: psy963


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MAEEVLQLVGLIGDEDSVVGFLLGGIGHQTITPPLQTVTSNVFVVDKETPADEIEDAFRTLVRRTDVGIVLITRLVADRIRHTLDIRERSNQVYPIVLEIPSALDAFHYTITDEDKQCRNIATLPKKK
ccccccEEEEEEccccHHHHHHHccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHccccccccEEEEEccccccccccccHHHHHHHHHccccccc
****VLQLVGLIGDEDSVVGFLLGGIGHQTITPPLQTVTSNVFVVDKETPADEIEDAFRTLVRRTDVGIVLITRLVADRIRHTLDIRERSNQVYPIVLEIPSALDAFHYTITDEDKQCRNIAT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEVLQLVGLIGDEDSVVGFLLGGIGHQTITPPLQTVTSNVFVVDKETPADEIEDAFRTLVRRTDVGIVLITRLVADRIRHTLDIRERSNQVYPIVLEIPSALDAFHYTITDEDKQCRNIATLPKKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
V-type proton ATPase subunit F Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentP39111
V-type proton ATPase subunit F Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentO43046
Probable V-type proton ATPase subunit F Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentQ23680

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051704 [BP]multi-organism processprobableGO:0008150
GO:0042625 [MF]ATPase activity, coupled to transmembrane movement of ionsprobableGO:0022891, GO:0016787, GO:0042626, GO:0016820, GO:0016818, GO:0042623, GO:0005215, GO:0043492, GO:0016817, GO:0003824, GO:0017111, GO:0015075, GO:0015399, GO:0022857, GO:0022892, GO:0003674, GO:0016887, GO:0016462, GO:0015405, GO:0022804
GO:0016471 [CC]vacuolar proton-transporting V-type ATPase complexprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0005774, GO:0044437, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0033176, GO:0044424, GO:0044425, GO:0016469, GO:0044422
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006875 [BP]cellular metal ion homeostasisprobableGO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0040007 [BP]growthprobableGO:0008150
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QAI, chain A
Confidence level:very confident
Coverage over the Query: 10-28,42-122
View the alignment between query and template
View the model in PyMOL