Diaphorina citri psyllid: psy9669


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECPTFVPEYIAIYPYKPQKDDELELRRGSVYTVTERCQDGWFKGTSQRTQRSGVFPGNYVAPAKFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFMKQSDFFI
cccccccccccccccccccccccccccccccCEccHHHHHHccccccccccccccccCEEEEccccccccccccCCcccEEEEEEECccccccCEEcccccEECccccccccccEEEEcccccccccccccccccEEEEEEEccccCEEEEEcccccEEEECcccEEEccccc
***WTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKC************CPECPTFVPEYIAIYPYKPQKDDELELRRGSVYTVTERCQDGWFKGTSQRTQRSGVFPGNYVAPAKFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFMKQSDFFI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECPTFVPEYIAIYPYKPQKDDELELRRGSVYTVTERCQDGWFKGTSQRTQRSGVFPGNYVAPAKFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFMKQSDFFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GRI, chain A
Confidence level:very confident
Coverage over the Query: 58-171
View the alignment between query and template
View the model in PyMOL
Template: 1E4U, chain A
Confidence level:confident
Coverage over the Query: 3-59
View the alignment between query and template
View the model in PyMOL