Diaphorina citri psyllid: psy9673


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPIINK
cccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHcccccccccccccEEEHHHccccccccccccccccccccCEEEEccccccCECccCEEEEccccEEEccccccccc
***WTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPII**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPIINK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0005078 [MF]MAP-kinase scaffold activityprobableGO:0005488, GO:0005198, GO:0035591, GO:0003674, GO:0032947, GO:0005515, GO:0060090
GO:0043154 [BP]negative regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0051346, GO:2000116, GO:2000117, GO:0043086, GO:0043067, GO:0010466, GO:0065007, GO:0044092, GO:0043281, GO:0065009, GO:0010259, GO:0006915, GO:0052547, GO:0052548, GO:0009987, GO:0050794, GO:0012501, GO:0044763, GO:0010951, GO:0051336, GO:0050790, GO:0008150
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0008103 [BP]oocyte microtubule cytoskeleton polarizationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0007163, GO:0000226, GO:0007309, GO:0007308, GO:0009798, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0030952, GO:0030951, GO:0048869, GO:0071840, GO:0016043, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0016325, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0044702, GO:0044763, GO:0022412, GO:0000003, GO:0006996, GO:0044767, GO:0007017, GO:0007010, GO:0044707, GO:0003006, GO:0048856, GO:0008150
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0046328 [BP]regulation of JNK cascadeprobableGO:0070302, GO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0032872, GO:0009966, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789, GO:0043408
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:2001237 [BP]negative regulation of extrinsic apoptotic signaling pathwayprobableGO:2001234, GO:2001236, GO:0010941, GO:0009968, GO:2001233, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0043067, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0042981, GO:0050789, GO:0048523
GO:0010923 [BP]negative regulation of phosphatase activityprobableGO:0051336, GO:0019220, GO:0051346, GO:0019222, GO:0065009, GO:0010921, GO:0050790, GO:0031323, GO:0050789, GO:0051174, GO:0065007, GO:0044092, GO:0008150, GO:0035303, GO:0050794, GO:0043086
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0042052 [BP]rhabdomere developmentprobableGO:0048666, GO:0044707, GO:0042051, GO:0030154, GO:0048468, GO:0001745, GO:0007275, GO:0071840, GO:0042462, GO:0042461, GO:0009653, GO:0048869, GO:0016043, GO:0048513, GO:0044699, GO:0048749, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0006996, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150, GO:0032502
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0008157 [MF]protein phosphatase 1 bindingprobableGO:0019899, GO:0019903, GO:0019902, GO:0003674, GO:0005488, GO:0005515
GO:0045451 [BP]pole plasm oskar mRNA localizationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0022607, GO:0016043, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0003006, GO:0070727, GO:0009948, GO:0007028, GO:0060811, GO:0060810, GO:0008298, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0019094, GO:0019953, GO:0007281, GO:0007316, GO:0007315, GO:0007314, GO:0008150, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0051179, GO:0051641, GO:0044767, GO:0006403, GO:0009952, GO:0044707, GO:0008595, GO:0044702, GO:0048856, GO:0044085, GO:0048869, GO:0044763, GO:0009987

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LQN, chain A
Confidence level:very confident
Coverage over the Query: 81-161
View the alignment between query and template
View the model in PyMOL
Template: 2ECN, chain A
Confidence level:very confident
Coverage over the Query: 4-57
View the alignment between query and template
View the model in PyMOL
Template: 3ZTG, chain A
Confidence level:confident
Coverage over the Query: 3-79
View the alignment between query and template
View the model in PyMOL