Psyllid ID: psy9673


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPIINK
ccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHcccccccccccccEEEHHHccccccccccccccccccccEEEEEccccccEEEccEEEEEccccEEEccccccccc
ccHHHHHHHcccccEHHccccccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccEEEEEEEccccccEEEEcccccEEEccEEEEccccHHccccccEEEEEEEEEEEEEccccccc
mdewtlndllecsvcldrldtsskvlpcqhtfCKKCLEEIVSShkelrcpecrvlveckvdelppnVLLMRILEGLFPLVVSFIRFFLNIldlnfkkddIVILRRKIdnnwfygevngttgafpmsyvqidnnwfygevngttgafpmSYVQFVWYLPIINK
mdewtlndLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKidnnwfygeVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPIINK
MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPIINK
***WTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPII**
***WTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLF*************************LRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPII**
MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPIINK
**EWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPIINK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHii
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFPLVVSFIRFFLNILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQIDNNWFYGEVNGTTGAFPMSYVQFVWYLPIINK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q8BZT2 735 Putative E3 ubiquitin-pro yes N/A 0.734 0.161 0.389 2e-31
Q8C120 878 SH3 domain-containing RIN no N/A 0.203 0.037 0.723 2e-30
Q8TEJ3 882 SH3 domain-containing RIN yes N/A 0.203 0.037 0.723 2e-30
Q6NRD3 826 E3 ubiquitin-protein liga N/A N/A 0.203 0.039 0.75 2e-30
Q28E95 861 E3 ubiquitin-protein liga no N/A 0.203 0.038 0.736 9e-30
A5D8S5 867 E3 ubiquitin-protein liga yes N/A 0.203 0.038 0.684 3e-27
Q71F54 894 E3 ubiquitin-protein liga no N/A 0.203 0.036 0.697 4e-27
Q69ZI1 892 E3 ubiquitin-protein liga no N/A 0.203 0.036 0.697 4e-27
Q5RBR0 888 E3 ubiquitin-protein liga no N/A 0.203 0.037 0.684 1e-26
Q7Z6J0 888 E3 ubiquitin-protein liga no N/A 0.203 0.037 0.684 1e-26
>sp|Q8BZT2|SH3R2_MOUSE Putative E3 ubiquitin-protein ligase SH3RF2 OS=Mus musculus GN=Sh3rf2 PE=1 SV=2 Back     alignment and function desciption
 Score =  135 bits (339), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 67/172 (38%), Positives = 92/172 (53%), Gaps = 53/172 (30%)

Query: 11  ECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLM 70
           EC VC ++LD ++KVLPCQHTFCK CL+ I  +HKELRCPECR LV C ++ LP N+LL+
Sbjct: 11  ECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKAHKELRCPECRTLVFCSIEALPANLLLV 70

Query: 71  RILEGL-------------------------------------FPLVVSFIRFFL----- 88
           R+L+G+                                     F LV S +R  +     
Sbjct: 71  RLLDGVRSGQSSWKGGSFRRPRILTLQDNRKAKSSPRSLQASPFRLVPS-VRIHMDGVPR 129

Query: 89  ----------NILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQI 130
                     N  DL F K D+++LRR++D NW+ GE+NG +G FP S V++
Sbjct: 130 AKALCNYRGKNPGDLKFNKGDVILLRRQLDENWYQGEINGVSGIFPASSVEV 181




Inhibits PPP1CA phosphatase activity. May be a E3 ubiquitin-protein ligase (Potential). May play a role in cardiac function.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8C120|SH3R3_MOUSE SH3 domain-containing RING finger protein 3 OS=Mus musculus GN=Sh3rf3 PE=2 SV=2 Back     alignment and function description
>sp|Q8TEJ3|SH3R3_HUMAN SH3 domain-containing RING finger protein 3 OS=Homo sapiens GN=SH3RF3 PE=1 SV=2 Back     alignment and function description
>sp|Q6NRD3|SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis GN=sh3rf1 PE=2 SV=1 Back     alignment and function description
>sp|Q28E95|SH3R1_XENTR E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus tropicalis GN=sh3rf1 PE=2 SV=1 Back     alignment and function description
>sp|A5D8S5|SH3R1_DANRE E3 ubiquitin-protein ligase SH3RF1 OS=Danio rerio GN=sh3rf1 PE=2 SV=2 Back     alignment and function description
>sp|Q71F54|SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus GN=Sh3rf1 PE=1 SV=1 Back     alignment and function description
>sp|Q69ZI1|SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus GN=Sh3rf1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RBR0|SH3R1_PONAB E3 ubiquitin-protein ligase SH3RF1 OS=Pongo abelii GN=SH3RF1 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z6J0|SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens GN=SH3RF1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
193695152 827 PREDICTED: putative E3 ubiquitin-protein 0.944 0.185 0.432 4e-46
270006379 779 plenty of SH3s [Tribolium castaneum] 0.944 0.196 0.408 2e-44
189236524 656 PREDICTED: similar to AGAP011487-PA [Tri 0.944 0.233 0.408 2e-44
242006001 744 conserved hypothetical protein [Pediculu 0.925 0.201 0.471 3e-40
357624146 800 hypothetical protein KGM_13238 [Danaus p 0.944 0.191 0.401 9e-40
170040334 846 Plenty of SH3s [Culex quinquefasciatus] 0.975 0.186 0.450 4e-39
405963292 784 SH3 domain-containing RING finger protei 0.944 0.195 0.388 2e-38
383851892 888 PREDICTED: SH3 domain-containing RING fi 0.469 0.085 0.881 7e-36
383851890 894 PREDICTED: SH3 domain-containing RING fi 0.469 0.085 0.881 7e-36
307195492 917 SH3 domain-containing RING finger protei 0.469 0.082 0.881 1e-35
>gi|193695152|ref|XP_001946794.1| PREDICTED: putative E3 ubiquitin-protein ligase SH3RF1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 100/231 (43%), Positives = 124/231 (53%), Gaps = 78/231 (33%)

Query: 1   MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKV 60
           MDE  LNDLLECSVCL+RL+TSSKVL CQHTFCKKCL+EIV++HKELRCPECR LV+C+V
Sbjct: 1   MDEKLLNDLLECSVCLERLNTSSKVLSCQHTFCKKCLDEIVATHKELRCPECRTLVDCRV 60

Query: 61  DELPPNVLLMRILEGLF----------------------PLVVSFIRFFLNIL------- 91
           DELPPNVLLMRILEG+                       P     + +  N+        
Sbjct: 61  DELPPNVLLMRILEGMKSKNATISPPKKPSAVACSDQRPPKTSKQVPYQRNMFARALYDY 120

Query: 92  ------DLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQ---------------- 129
                 DL+FKK D++ILR+K+D+NW+ GE NG  G FP+SYVQ                
Sbjct: 121 SSKEPGDLSFKKGDMIILRQKVDSNWYQGEANGVIGIFPLSYVQVFPTSLPSHIPQCKAL 180

Query: 130 ---------------------------IDNNWFYGEVNGTTGAFPMSYVQF 153
                                      ID NW  G+++   G FP+S+V  
Sbjct: 181 YDFKMNKEDDEGCLSFSKGDIITVLRRIDQNWAEGKISNRIGIFPLSFVDL 231




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270006379|gb|EFA02827.1| plenty of SH3s [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189236524|ref|XP_975448.2| PREDICTED: similar to AGAP011487-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242006001|ref|XP_002423847.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507069|gb|EEB11109.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357624146|gb|EHJ75026.1| hypothetical protein KGM_13238 [Danaus plexippus] Back     alignment and taxonomy information
>gi|170040334|ref|XP_001847958.1| Plenty of SH3s [Culex quinquefasciatus] gi|167863885|gb|EDS27268.1| Plenty of SH3s [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|405963292|gb|EKC28879.1| SH3 domain-containing RING finger protein 3 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|383851892|ref|XP_003701465.1| PREDICTED: SH3 domain-containing RING finger protein 3-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383851890|ref|XP_003701464.1| PREDICTED: SH3 domain-containing RING finger protein 3-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307195492|gb|EFN77378.1| SH3 domain-containing RING finger protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
FB|FBgn0040294 838 POSH "Plenty of SH3s" [Drosoph 0.469 0.090 0.815 1.7e-47
UNIPROTKB|F1NYR2 892 SH3RF1 "Uncharacterized protei 0.469 0.085 0.723 2.5e-42
UNIPROTKB|C9JNJ4 716 SH3RF3 "SH3 domain-containing 0.469 0.106 0.723 5.1e-42
MGI|MGI:2444637 878 Sh3rf3 "SH3 domain containing 0.469 0.086 0.723 1.9e-41
UNIPROTKB|Q8TEJ3 882 SH3RF3 "SH3 domain-containing 0.469 0.086 0.723 1.9e-41
UNIPROTKB|F1PBV0 882 SH3RF3 "Uncharacterized protei 0.469 0.086 0.723 5e-41
RGD|735154 894 Sh3rf1 "SH3 domain containing 0.469 0.085 0.697 1.7e-40
UNIPROTKB|Q71F54 894 Sh3rf1 "E3 ubiquitin-protein l 0.469 0.085 0.697 1.7e-40
UNIPROTKB|F1Q3X8 882 SH3RF1 "Uncharacterized protei 0.469 0.086 0.684 5.5e-40
MGI|MGI:1913066 892 Sh3rf1 "SH3 domain containing 0.469 0.085 0.697 5.7e-40
FB|FBgn0040294 POSH "Plenty of SH3s" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 354 (129.7 bits), Expect = 1.7e-47, Sum P(3) = 1.7e-47
 Identities = 62/76 (81%), Positives = 72/76 (94%)

Query:     1 MDEWTLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKV 60
             MDE TLNDLLECSVCL+RLDT+SKVLPCQHTFC+KCL++IV+S  +LRCPECR+LV CK+
Sbjct:     1 MDEHTLNDLLECSVCLERLDTTSKVLPCQHTFCRKCLQDIVASQHKLRCPECRILVSCKI 60

Query:    61 DELPPNVLLMRILEGL 76
             DELPPNVLLMRILEG+
Sbjct:    61 DELPPNVLLMRILEGM 76


GO:0008340 "determination of adult lifespan" evidence=NAS;IMP
GO:0008104 "protein localization" evidence=IMP
GO:0045451 "pole plasm oskar mRNA localization" evidence=IMP
GO:0008103 "oocyte microtubule cytoskeleton polarization" evidence=IMP
GO:0042052 "rhabdomere development" evidence=IMP
GO:0030159 "receptor signaling complex scaffold activity" evidence=NAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0060548 "negative regulation of cell death" evidence=IMP
UNIPROTKB|F1NYR2 SH3RF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|C9JNJ4 SH3RF3 "SH3 domain-containing RING finger protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444637 Sh3rf3 "SH3 domain containing ring finger 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TEJ3 SH3RF3 "SH3 domain-containing RING finger protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBV0 SH3RF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|735154 Sh3rf1 "SH3 domain containing ring finger 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q71F54 Sh3rf1 "E3 ubiquitin-protein ligase SH3RF1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3X8 SH3RF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913066 Sh3rf1 "SH3 domain containing ring finger 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
cd1178653 cd11786, SH3_SH3RF_1, First Src Homology 3 domain 1e-16
cd1192854 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain 1e-14
cd1192754 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain 1e-12
cd1178153 cd11781, SH3_Sorbs_1, First Src Homology 3 domain 3e-12
cd1192954 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain 5e-12
cd1178253 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain 2e-11
cd1192055 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain 7e-11
cd1180355 cd11803, SH3_Endophilin_A, Src homology 3 domain o 2e-10
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-09
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 9e-09
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 9e-09
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 1e-08
cd1191955 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain 3e-08
cd1186954 cd11869, SH3_p40phox, Src Homology 3 domain of the 3e-08
smart0018440 smart00184, RING, Ring finger 4e-08
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 4e-08
cd1192155 cd11921, SH3_Vinexin_1, First Src Homology 3 domai 4e-08
cd1192456 cd11924, SH3_Vinexin_2, Second Src Homology 3 doma 1e-07
cd1192357 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai 2e-07
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 2e-07
cd1188456 cd11884, SH3_MYO15, Src Homology 3 domain of Myosi 2e-07
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 4e-07
cd1192258 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domai 5e-07
smart0032656 smart00326, SH3, Src homology 3 domains 6e-07
cd1180355 cd11803, SH3_Endophilin_A, Src homology 3 domain o 8e-07
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 1e-06
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 1e-06
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 1e-06
cd1184255 cd11842, SH3_Ysc84p_like, Src homology 3 domain of 1e-06
cd1199052 cd11990, SH3_Intersectin2_2, Second Src homology 3 2e-06
cd1181651 cd11816, SH3_Eve1_3, Third Src homology 3 domain o 2e-06
cd1187753 cd11877, SH3_PIX, Src Homology 3 domain of Pak Int 2e-06
cd1195655 cd11956, SH3_srGAP4, Src homology 3 domain of Slit 2e-06
cd1181552 cd11815, SH3_Eve1_2, Second Src homology 3 domain 2e-06
cd1183054 cd11830, SH3_VAV_2, C-terminal (or second) Src hom 6e-06
cd1204653 cd12046, SH3_p67phox_C, C-terminal (or second) Src 6e-06
cd1191955 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain 1e-05
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 1e-05
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 1e-05
cd1179651 cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo 2e-05
cd1178753 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain 2e-05
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 3e-05
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 4e-05
cd1195953 cd11959, SH3_Cortactin, Src homology 3 domain of C 4e-05
cd1197261 cd11972, SH3_Abi2, Src homology 3 domain of Abl In 5e-05
cd1180953 cd11809, SH3_srGAP, Src homology 3 domain of Slit- 5e-05
cd1193055 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domai 5e-05
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 5e-05
cd1187555 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do 5e-05
cd1198952 cd11989, SH3_Intersectin1_2, Second Src homology 3 5e-05
cd1182153 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP 6e-05
cd1199152 cd11991, SH3_Intersectin1_3, Third Src homology 3 6e-05
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 7e-05
cd1194656 cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom 8e-05
cd1183753 cd11837, SH3_Intersectin_2, Second Src homology 3 9e-05
cd1184154 cd11841, SH3_SH3YL1_like, Src homology 3 domain of 1e-04
cd1196153 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src 1e-04
cd1187053 cd11870, SH3_p67phox-like_C, C-terminal Src Homolo 1e-04
cd1178555 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homo 1e-04
cd1197758 cd11977, SH3_VAV2_2, C-terminal (or second) Src ho 2e-04
cd1197159 cd11971, SH3_Abi1, Src homology 3 domain of Abl In 2e-04
cd1193257 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domai 2e-04
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 2e-04
cd1180452 cd11804, SH3_GRB2_like_N, N-terminal Src homology 2e-04
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 2e-04
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 2e-04
cd1197654 cd11976, SH3_VAV1_2, C-terminal (or second) Src ho 3e-04
cd1177851 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain 3e-04
cd1197856 cd11978, SH3_VAV3_2, C-terminal (or second) Src ho 3e-04
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 3e-04
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 3e-04
cd1183655 cd11836, SH3_Intersectin_1, First Src homology 3 d 3e-04
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 4e-04
cd1181750 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain 4e-04
cd1206058 cd12060, SH3_alphaPIX, Src Homology 3 domain of al 4e-04
cd1183852 cd11838, SH3_Intersectin_3, Third Src homology 3 d 4e-04
cd1193155 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domai 4e-04
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 5e-04
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 6e-04
cd1193459 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do 6e-04
cd1192155 cd11921, SH3_Vinexin_1, First Src Homology 3 domai 8e-04
cd1175855 cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma 8e-04
cd1181850 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o 0.001
cd1178955 cd11789, SH3_Nebulin_family_C, C-terminal Src Homo 0.001
cd1176653 cd11766, SH3_Nck_2, Second Src Homology 3 domain o 0.001
cd1181252 cd11812, SH3_AHI-1, Src Homology 3 domain of Abels 0.001
cd1192357 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai 0.002
cd1177160 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain 0.002
cd1181353 cd11813, SH3_SGSM3, Src Homology 3 domain of Small 0.002
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 0.002
cd1176957 cd11769, SH3_CSK, Src Homology 3 domain of C-termi 0.002
cd1194752 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do 0.002
cd1205657 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain 0.002
cd1214255 cd12142, SH3_D21-like, Src Homology 3 domain of SH 0.002
cd1192258 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domai 0.003
cd1193558 cd11935, SH3_Nebulette_C, C-terminal Src Homology 0.003
pfam0001847 pfam00018, SH3_1, SH3 domain 0.003
cd1188760 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a 0.003
cd1177957 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain 0.003
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 0.004
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 0.004
cd1180653 cd11806, SH3_PRMT2, Src homology 3 domain of Prote 0.004
cd1194854 cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom 0.004
cd1204753 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 do 0.004
>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
 Score = 69.3 bits (170), Expect = 1e-16
 Identities = 24/39 (61%), Positives = 32/39 (82%)

Query: 92  DLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQI 130
           DL+FKK DI++LR++ID NW++GE NG  G FP SYVQ+
Sbjct: 15  DLSFKKGDIILLRKRIDENWYHGECNGKQGFFPASYVQV 53


This model represents the first SH3 domain of SH3RF1 (or POSH), SH3RF2 (or POSHER), SH3RF3 (POSH2), and similar domains. Members of this family are scaffold proteins that function as E3 ubiquitin-protein ligases. They all contain an N-terminal RING finger domain and multiple SH3 domains; SH3RF1 and SH3RF3 have four SH3 domains while SH3RF2 has three. SH3RF1 plays a role in calcium homeostasis through the control of the ubiquitin domain protein Herp. It may also have a role in regulating death receptor mediated and JNK mediated apoptosis. SH3RF3 interacts with p21-activated kinase 2 (PAK2) and GTP-loaded Rac1. It may play a role in regulating JNK mediated apoptosis in certain conditions. SH3RF2 acts as an anti-apoptotic regulator of the JNK pathway by binding to and promoting the degradation of SH3RF1. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 53

>gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins Back     alignment and domain information
>gnl|CDD|212923 cd11990, SH3_Intersectin2_2, Second Src homology 3 domain (or SH3B) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors Back     alignment and domain information
>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 Back     alignment and domain information
>gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins Back     alignment and domain information
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin Back     alignment and domain information
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 Back     alignment and domain information
>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|212863 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212922 cd11989, SH3_Intersectin1_2, Second Src homology 3 domain (or SH3B) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin Back     alignment and domain information
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein Back     alignment and domain information
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins Back     alignment and domain information
>gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein Back     alignment and domain information
>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 Back     alignment and domain information
>gnl|CDD|212865 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein Back     alignment and domain information
>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin Back     alignment and domain information
>gnl|CDD|212864 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 Back     alignment and domain information
>gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins Back     alignment and domain information
>gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins Back     alignment and domain information
>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) Back     alignment and domain information
>gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p Back     alignment and domain information
>gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins Back     alignment and domain information
>gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains Back     alignment and domain information
>gnl|CDD|212713 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain of Insulin Receptor tyrosine kinase Substrate p53, Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2 (BAIAP2)-Like proteins, and similar proteins Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 Back     alignment and domain information
>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212980 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 domain of NADPH oxidase activator 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
KOG4348|consensus 627 99.67
KOG4225|consensus 489 99.63
KOG4226|consensus 379 99.61
KOG4348|consensus 627 99.56
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.51
KOG1029|consensus1118 99.48
KOG1029|consensus 1118 99.47
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.4
KOG0287|consensus 442 99.39
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.39
KOG4792|consensus293 99.38
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.34
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.28
KOG1118|consensus366 99.28
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.27
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 99.27
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.25
KOG4226|consensus 379 99.24
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 99.23
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.22
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.21
KOG4225|consensus489 99.2
PHA02929238 N1R/p28-like protein; Provisional 99.19
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.18
KOG0823|consensus230 99.13
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.13
KOG0317|consensus293 99.12
PF1463444 zf-RING_5: zinc-RING finger domain 99.09
KOG2199|consensus 462 99.07
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.05
KOG2070|consensus 661 99.04
KOG0320|consensus187 99.02
PHA02926242 zinc finger-like protein; Provisional 98.99
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.98
KOG2996|consensus 865 98.95
KOG2177|consensus 386 98.9
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.85
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.83
KOG2164|consensus 513 98.79
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.73
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 98.71
KOG4628|consensus348 98.67
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.66
KOG3601|consensus 222 98.64
KOG2996|consensus865 98.63
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.61
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 98.61
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.6
KOG2660|consensus 331 98.57
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.53
KOG0311|consensus 381 98.49
KOG3632|consensus1335 98.49
KOG4159|consensus 398 98.47
KOG0802|consensus543 98.46
KOG0978|consensus698 98.45
KOG0162|consensus1106 98.44
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.34
KOG2856|consensus472 98.23
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.22
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 98.22
KOG2879|consensus298 98.21
KOG0824|consensus 324 98.21
COG5152259 Uncharacterized conserved protein, contains RING a 98.21
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.15
KOG1039|consensus344 98.08
KOG2070|consensus 661 98.0
KOG1843|consensus473 97.95
KOG0515|consensus752 97.9
KOG1264|consensus 1267 97.9
KOG1813|consensus313 97.88
KOG1734|consensus328 97.85
KOG0804|consensus 493 97.82
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.81
KOG2546|consensus483 97.81
KOG0297|consensus 391 97.8
KOG2546|consensus483 97.77
KOG4172|consensus62 97.66
KOG3601|consensus222 97.65
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.64
KOG1702|consensus264 97.63
KOG3655|consensus484 97.61
KOG3523|consensus695 97.55
KOG4792|consensus293 97.55
KOG1002|consensus791 97.53
KOG4185|consensus 296 97.5
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 97.48
KOG4265|consensus349 97.47
KOG4367|consensus 699 97.47
COG5222427 Uncharacterized conserved protein, contains RING Z 97.47
COG52191525 Uncharacterized conserved protein, contains RING Z 97.45
KOG1785|consensus563 97.44
KOG3875|consensus362 97.43
KOG1451|consensus812 97.29
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.26
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 97.23
KOG2222|consensus 848 97.16
KOG1941|consensus518 97.14
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.14
KOG3655|consensus484 97.13
KOG3002|consensus 299 97.06
KOG3725|consensus375 96.98
KOG0828|consensus636 96.94
KOG1493|consensus84 96.91
KOG0827|consensus 465 96.89
KOG1118|consensus366 96.82
KOG1264|consensus 1267 96.79
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.75
KOG2930|consensus114 96.7
KOG0825|consensus 1134 96.7
KOG2856|consensus472 96.64
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 96.63
KOG4692|consensus489 96.63
KOG1645|consensus 463 96.61
KOG4575|consensus 874 96.6
KOG3039|consensus303 96.6
KOG4275|consensus350 96.34
KOG0826|consensus357 96.31
KOG1001|consensus674 96.31
KOG1451|consensus812 96.27
KOG1571|consensus355 96.24
KOG0162|consensus1106 96.23
KOG4278|consensus 1157 96.21
KOG1843|consensus473 96.2
KOG1814|consensus445 96.2
KOG4773|consensus 386 96.15
KOG2817|consensus394 96.15
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 96.12
KOG4739|consensus233 96.07
KOG3775|consensus 482 96.03
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 96.0
KOG3800|consensus 300 95.99
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 95.91
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.81
PF04641260 Rtf2: Rtf2 RING-finger 95.78
KOG2528|consensus 490 95.59
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.59
KOG2114|consensus933 95.52
PHA02825162 LAP/PHD finger-like protein; Provisional 95.42
KOG3161|consensus 861 95.37
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.09
KOG1702|consensus264 95.02
KOG2932|consensus 389 94.97
KOG3632|consensus1335 94.86
KOG4445|consensus368 94.85
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 94.8
KOG4773|consensus 386 94.53
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 94.46
KOG0197|consensus 468 94.41
KOG0609|consensus 542 94.1
KOG1940|consensus276 94.02
PHA03096284 p28-like protein; Provisional 94.01
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 93.99
KOG4362|consensus 684 93.85
KOG4429|consensus421 93.6
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 93.44
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.25
COG5109396 Uncharacterized conserved protein, contains RING Z 93.19
smart0028763 SH3b Bacterial SH3 domain homologues. 92.83
KOG0298|consensus1394 92.45
PHA02862156 5L protein; Provisional 92.16
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 92.15
KOG3970|consensus299 92.1
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 91.77
PF10272358 Tmpp129: Putative transmembrane protein precursor; 91.55
KOG1100|consensus207 91.41
KOG1952|consensus 950 90.86
KOG2222|consensus 848 90.8
KOG1428|consensus3738 90.65
KOG1812|consensus384 90.43
KOG3039|consensus 303 90.28
KOG3268|consensus234 90.17
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 89.68
KOG4575|consensus 874 89.55
KOG3523|consensus695 89.28
KOG3812|consensus 475 89.09
KOG2034|consensus911 88.8
PF0634755 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S 88.33
KOG1815|consensus 444 88.25
KOG2528|consensus 490 88.02
KOG0199|consensus 1039 87.06
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 86.98
PRK10884206 SH3 domain-containing protein; Provisional 86.9
KOG3579|consensus352 86.47
KOG3113|consensus293 86.06
KOG4429|consensus421 85.83
KOG3899|consensus381 85.35
KOG3771|consensus460 85.1
KOG3775|consensus 482 84.79
KOG2169|consensus 636 82.82
KOG2199|consensus 462 81.77
COG381384 Uncharacterized protein conserved in bacteria [Fun 80.91
PF0690657 DUF1272: Protein of unknown function (DUF1272); In 80.29
KOG4278|consensus 1157 80.13
>KOG4348|consensus Back     alignment and domain information
Probab=99.67  E-value=9.7e-18  Score=126.30  Aligned_cols=41  Identities=32%  Similarity=0.694  Sum_probs=39.6

Q ss_pred             cceeeccCCCEEEEeEecCCCeEEEEecCCCCceeeeeEEe
Q psy9673          90 ILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQI  130 (162)
Q Consensus        90 ~~el~~~~gd~i~v~~~~~~~w~~g~~~~~~G~~P~~~v~~  130 (162)
                      .++|.+..||+|.+.....++||.|.++|+.|+||+|||..
T Consensus       114 dDELelkVGDiIeli~eVEeGWw~G~Lngk~GmFPsNFVke  154 (627)
T KOG4348|consen  114 DDELELKVGDIIELISEVEEGWWKGKLNGKVGMFPSNFVKE  154 (627)
T ss_pred             CceeeeeeccHHHhhhHhhhhhhhceecCcccccchhhcee
Confidence            78999999999999999999999999999999999999996



>KOG4225|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>KOG3113|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG3899|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG2169|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
2djq_A68 The Solution Structure Of The First Sh3 Domain Of M 1e-08
3c0c_A73 X-Ray Crystal Structure Of The Rat Endophilin A2 Sh 2e-06
1w6x_A60 Sh3 Domain Of P40phox, Component Of The Nadph Oxida 3e-06
2dyb_A341 The Crystal Structure Of Human P40(Phox) Length = 3 4e-06
1z9q_A79 Solution Structure Of Sh3 Domain Of P40phox Length 4e-06
2dbm_A73 Solution Structures Of The Sh3 Domain Of Human Sh3- 6e-06
3iql_A71 Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma 7e-06
2ew3_A68 Solution Structure Of The Sh3 Domain Of Human Sh3gl 8e-06
2yun_A79 Solution Structure Of The Sh3 Domain Of Human Nostr 2e-05
2nwm_A65 Solution Structure Of The First Sh3 Domain Of Human 6e-05
2yup_A90 Solution Structure Of The Second Sh3 Domain Of Huma 8e-05
2dlm_A68 Solution Structure Of The First Sh3 Domain Of Human 8e-05
2dl3_A68 Solution Structure Of The First Sh3 Domain Of Human 9e-05
1j3t_A74 Solution Structure Of The Second Sh3 Domain Of Huma 2e-04
2a08_A60 Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 2e-04
1gri_A 217 Grb2 Length = 217 3e-04
1udl_A98 The Solution Structure Of The Fifth Sh3 Domain Of I 3e-04
3gf9_A 295 Crystal Structure Of Human Intersectin 2 Rhogef Dom 4e-04
2ecz_A70 Solution Structure Of The Sh3 Domain Of Sorbin And 6e-04
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 7e-04
2o2w_A67 Extending Powder Diffraction To Proteins: Structure 7e-04
2i0n_A80 Structure Of Dictyostelium Discoideum Myosin Vii Sh 7e-04
>pdb|2DJQ|A Chain A, The Solution Structure Of The First Sh3 Domain Of Mouse Sh3 Domain Containing Ring Finger 2 Length = 68 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 21/42 (50%), Positives = 31/42 (73%) Query: 89 NILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQI 130 N DL F K D+++LRR++D NW+ GE+NG +G FP S V++ Sbjct: 20 NPGDLKFNKGDVILLRRQLDENWYQGEINGVSGIFPASSVEV 61
>pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 Back     alignment and structure
>pdb|1W6X|A Chain A, Sh3 Domain Of P40phox, Component Of The Nadph Oxidase Length = 60 Back     alignment and structure
>pdb|2DYB|A Chain A, The Crystal Structure Of Human P40(Phox) Length = 341 Back     alignment and structure
>pdb|1Z9Q|A Chain A, Solution Structure Of Sh3 Domain Of P40phox Length = 79 Back     alignment and structure
>pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 Back     alignment and structure
>pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 Back     alignment and structure
>pdb|2EW3|A Chain A, Solution Structure Of The Sh3 Domain Of Human Sh3gl3 Length = 68 Back     alignment and structure
>pdb|2YUN|A Chain A, Solution Structure Of The Sh3 Domain Of Human Nostrin Length = 79 Back     alignment and structure
>pdb|2NWM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin And Its Interaction With The Peptides From Vinculin Length = 65 Back     alignment and structure
>pdb|2YUP|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Vinexin Length = 90 Back     alignment and structure
>pdb|2DLM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin Length = 68 Back     alignment and structure
>pdb|2DL3|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Sorbin And Sh3 Domain-Containing Protein 1 Length = 68 Back     alignment and structure
>pdb|1J3T|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Intersectin 2 (Kiaa1256) Length = 74 Back     alignment and structure
>pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 Back     alignment and structure
>pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 Back     alignment and structure
>pdb|2ECZ|A Chain A, Solution Structure Of The Sh3 Domain Of Sorbin And Sh3 Domain-Containing Protein 1 Length = 70 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure
>pdb|2O2W|A Chain A, Extending Powder Diffraction To Proteins: Structure Solution Of The Second Sh3 Domain From Ponsin Length = 67 Back     alignment and structure
>pdb|2I0N|A Chain A, Structure Of Dictyostelium Discoideum Myosin Vii Sh3 Domain With Adjacent Proline Rich Region Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 8e-23
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 2e-15
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 6e-10
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 4e-15
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 6e-15
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 8e-15
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 9e-15
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 1e-14
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-14
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 2e-14
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 3e-14
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 3e-14
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 4e-14
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 4e-14
1z6u_A150 NP95-like ring finger protein isoform B; structura 6e-14
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 7e-14
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 9e-14
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 1e-13
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 2e-13
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 2e-13
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 4e-13
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 5e-13
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 6e-13
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 7e-13
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 8e-13
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 9e-13
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 1e-12
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 2e-12
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-12
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 2e-12
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 2e-12
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 3e-12
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 3e-12
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 3e-12
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 3e-12
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 3e-12
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 4e-12
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 4e-12
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 5e-12
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 6e-12
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 7e-12
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 8e-12
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 1e-11
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 1e-11
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 1e-11
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-11
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 1e-11
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 1e-11
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 1e-11
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 1e-11
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-11
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 2e-11
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 2e-11
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 2e-11
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 2e-11
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-11
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 2e-11
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 2e-11
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 2e-11
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 2e-11
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 2e-11
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-11
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 3e-11
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 3e-11
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 3e-11
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 4e-11
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 4e-11
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 5e-11
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 5e-11
2dil_A69 Proline-serine-threonine phosphatase-interacting p 6e-11
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 6e-11
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 6e-11
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 7e-11
3u23_A65 CD2-associated protein; structural genomics, struc 8e-11
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 8e-11
2da9_A70 SH3-domain kinase binding protein 1; structural ge 8e-11
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 9e-11
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-10
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-10
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 1e-10
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 2e-10
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 2e-10
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 3e-10
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 3e-10
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 3e-10
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 3e-10
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 4e-10
1uti_A58 GRB2-related adaptor protein 2; signaling protein 4e-10
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 4e-10
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 5e-10
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 7e-10
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 7e-10
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 9e-10
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 1e-09
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 5e-08
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 1e-09
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 1e-09
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 2e-09
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-09
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-09
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 2e-09
2ysl_A73 Tripartite motif-containing protein 31; ring-type 3e-09
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-09
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 3e-09
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 3e-09
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 3e-09
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 4e-09
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 4e-09
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 4e-09
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 4e-09
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 6e-09
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 6e-09
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 9e-09
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 9e-09
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 1e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-08
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 1e-08
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 2e-08
2cuc_A70 SH3 domain containing ring finger 2; structural ge 2e-08
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 2e-08
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 2e-08
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 2e-08
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 2e-08
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 3e-08
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 4e-04
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 3e-08
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-08
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 3e-08
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-08
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 3e-08
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 3e-08
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 4e-08
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 4e-08
2j6f_A62 CD2-associated protein; metal-binding, immune resp 5e-08
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 5e-08
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 5e-08
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 6e-08
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 6e-08
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 5e-05
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 7e-08
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 7e-08
2ect_A78 Ring finger protein 126; metal binding protein, st 7e-08
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 9e-08
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 1e-07
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 1e-07
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 7e-05
2ysj_A63 Tripartite motif-containing protein 31; ring-type 1e-07
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 1e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-07
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 2e-07
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 2e-07
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-07
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 2e-07
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 2e-07
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 2e-07
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 3e-07
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-07
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 3e-07
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 4e-07
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 4e-07
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 4e-07
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 4e-07
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 5e-07
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-06
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 5e-07
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 6e-07
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 6e-07
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 7e-07
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 8e-07
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 8e-07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 8e-07
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 9e-07
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 1e-06
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 1e-06
1wxb_A68 Epidermal growth factor receptor pathway substrate 1e-06
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 1e-06
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-06
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 1e-06
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-06
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 1e-06
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 2e-06
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 2e-06
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 3e-06
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-06
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 3e-06
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 4e-06
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 5e-06
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 5e-06
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 5e-06
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 6e-06
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 7e-06
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 8e-06
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 9e-06
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 9e-06
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 1e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-05
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 2e-05
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 2e-05
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 2e-05
1awj_A77 ITK; transferase, regulatory intramolecular comple 2e-05
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 3e-05
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 4e-05
3nw0_A238 Non-structural maintenance of chromosomes element 4e-05
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 4e-05
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 5e-05
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 6e-05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 7e-05
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 8e-05
2ea5_A68 Cell growth regulator with ring finger domain prot 1e-04
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 1e-04
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 1e-04
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 1e-04
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 1e-04
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 1e-04
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 1e-04
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 1e-04
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 1e-04
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 2e-04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 2e-04
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 5e-04
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 5e-04
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 5e-04
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 6e-04
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 6e-04
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 6e-04
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 6e-04
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 8e-04
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
 Score = 85.5 bits (212), Expect = 8e-23
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 6  LNDLLECSVCLDRLDTSS---KVLPCQHTFCKKCLEEIVSSH-KELRCPECRVLVECK-V 60
          L ++LEC +C++         K+L C HT C++CLE++++S    +RCP C  +     +
Sbjct: 12 LREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSL 71

Query: 61 DELPPNVLLMRILEG 75
           +L  N+ +++    
Sbjct: 72 TQLTDNLTVLKSGPS 86


>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.74
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.7
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.68
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.67
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.66
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.64
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.63
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.63
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.62
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.62
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.61
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.6
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.39
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.59
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.59
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.59
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.59
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.58
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.58
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.57
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.56
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 99.56
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.56
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.53
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.53
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.51
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.51
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.5
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.5
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.5
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.49
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.48
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.47
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.47
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.46
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.46
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.46
2ect_A78 Ring finger protein 126; metal binding protein, st 99.45
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.44
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.42
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.42
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.42
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.41
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.41
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.41
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.4
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.4
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.4
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.39
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.39
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.38
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.38
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.38
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.37
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.37
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.37
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.37
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.37
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.36
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.36
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.34
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.34
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.33
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.33
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.33
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.32
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.32
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.32
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.31
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.31
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.31
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.3
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.29
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.29
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.28
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.28
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.27
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.27
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.27
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.26
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.26
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.26
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.26
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.26
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.25
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.25
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.25
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.25
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.25
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.24
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.24
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.24
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.24
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.24
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.23
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.23
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.23
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.23
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.23
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.23
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.22
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.22
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.22
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.22
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.22
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.22
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.22
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.22
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.22
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.22
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.22
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.21
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.21
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.21
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.2
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.2
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.2
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.2
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.2
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.2
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.19
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.19
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.19
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.19
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.19
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.18
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.18
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.18
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.18
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.18
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.18
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.17
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.17
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.17
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.17
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.17
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.17
3u23_A65 CD2-associated protein; structural genomics, struc 99.17
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.16
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.16
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.16
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.16
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.16
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.16
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.15
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.15
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.15
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.15
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.15
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.15
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.14
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.14
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.14
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.14
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.14
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.14
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.14
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.13
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.13
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.13
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.13
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.13
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.12
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.12
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.12
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.12
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.12
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.11
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.11
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.11
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.11
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.11
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.11
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.11
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.1
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.1
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.1
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 99.1
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.1
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.1
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.09
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.09
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.09
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.08
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.08
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.08
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.08
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.08
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.07
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.07
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.07
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.07
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.07
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.07
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.06
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.06
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.06
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.06
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.06
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.06
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.05
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.05
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.05
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.05
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.04
1i07_A60 Epidermal growth factor receptor kinase substrate 99.04
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.03
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.02
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.02
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.02
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.01
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.0
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.0
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.0
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.0
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.0
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.99
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.99
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 98.99
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 98.99
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 98.99
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 98.99
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 98.98
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 98.97
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 98.96
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 98.95
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 98.95
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.94
2ea5_A68 Cell growth regulator with ring finger domain prot 98.94
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 98.93
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 98.93
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.93
1wxb_A68 Epidermal growth factor receptor pathway substrate 98.93
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 98.92
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.92
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 98.92
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.92
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 98.91
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.91
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 98.9
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 98.9
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 98.9
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 98.88
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 98.87
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.87
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 98.84
1awj_A77 ITK; transferase, regulatory intramolecular comple 98.83
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.83
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 98.83
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 98.83
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 98.81
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 98.81
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.78
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.78
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.76
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 98.75
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 98.74
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 98.74
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.73
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 98.71
1uti_A58 GRB2-related adaptor protein 2; signaling protein 98.7
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 98.69
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 98.69
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 98.69
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 98.69
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 98.69
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 98.68
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 98.68
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 98.68
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.68
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 98.67
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 98.67
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 98.67
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 98.67
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.66
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 98.66
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.66
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 98.65
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.65
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 98.65
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 98.65
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 98.64
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 98.63
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.06
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 98.63
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 98.62
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 98.62
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 98.61
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 98.61
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 98.61
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 98.61
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 98.61
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 98.61
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 98.6
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 98.6
3u23_A65 CD2-associated protein; structural genomics, struc 98.6
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 98.6
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 98.59
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 98.59
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 98.59
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 98.59
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 98.59
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 98.58
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.58
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 98.58
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 98.58
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 98.57
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 98.57
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 98.57
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 98.57
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 98.57
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 98.57
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 98.55
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 98.55
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 98.54
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 98.54
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.54
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 98.54
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 98.54
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 98.53
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 98.53
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 98.53
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 98.53
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 98.53
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 98.52
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.52
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 98.52
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 98.52
2da9_A70 SH3-domain kinase binding protein 1; structural ge 98.52
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 98.51
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 98.51
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 98.5
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 98.5
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 98.5
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 98.5
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 98.5
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 98.5
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 98.49
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 98.49
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 98.49
2dil_A69 Proline-serine-threonine phosphatase-interacting p 98.48
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.48
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 98.47
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 98.46
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 98.46
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 98.45
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 98.45
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 98.45
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 98.44
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 98.44
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.44
2cuc_A70 SH3 domain containing ring finger 2; structural ge 98.44
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 98.44
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 98.44
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 98.43
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 98.43
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 98.43
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 98.43
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 98.43
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 98.42
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 98.41
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 98.41
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 98.4
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 98.4
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 98.4
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 98.4
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 98.4
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 98.39
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 98.39
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 98.39
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 98.39
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 98.38
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 98.38
1i07_A60 Epidermal growth factor receptor kinase substrate 98.37
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 98.37
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 98.36
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 98.35
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 98.34
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 98.34
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 98.33
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 98.33
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 98.33
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 98.32
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 98.32
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 98.31
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 98.3
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 98.27
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 98.25
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 98.25
1wxb_A68 Epidermal growth factor receptor pathway substrate 98.24
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 98.23
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.23
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 98.23
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.22
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 98.22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.21
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.21
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 98.21
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 98.2
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 98.2
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 98.19
2dyb_A 341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 98.18
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 98.16
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 98.14
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 98.12
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 98.12
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 98.12
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.11
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.1
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 98.08
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 98.07
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 98.06
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 98.05
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 98.03
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 98.02
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.01
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 97.99
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 97.96
1awj_A77 ITK; transferase, regulatory intramolecular comple 97.95
1u3o_A82 Huntingtin-associated protein-interacting protein; 97.9
3a98_A 184 DOCK2, dedicator of cytokinesis protein 2; protein 97.84
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 97.82
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 97.69
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 97.68
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 97.67
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 97.67
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 97.66
3nw0_A238 Non-structural maintenance of chromosomes element 97.62
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 97.62
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 97.57
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 97.53
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 97.48
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 97.37
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 97.32
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 97.31
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 97.29
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 97.23
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 97.17
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.09
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.03
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 97.0
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 96.98
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 96.88
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 96.72
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 96.72
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 96.69
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 96.45
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 96.42
1u3o_A82 Huntingtin-associated protein-interacting protein; 96.36
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 96.29
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 96.27
2j6f_A62 CD2-associated protein; metal-binding, immune resp 96.25
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 96.23
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 96.12
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 96.08
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 95.98
3npf_A 306 Putative dipeptidyl-peptidase VI; structural genom 95.95
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 95.75
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 95.72
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 95.67
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 95.57
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 95.52
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 95.51
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 95.51
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 95.45
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 95.41
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 95.4
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 95.35
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.32
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 95.32
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 95.28
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 95.19
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 95.08
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 95.06
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 95.03
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 94.95
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 94.75
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 94.71
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 94.7
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 94.47
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 94.14
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 93.89
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 93.83
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 93.32
2kt8_A76 Probable surface protein; SH3 family, structural g 93.14
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 93.04
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 92.95
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 92.85
2kt8_A76 Probable surface protein; SH3 family, structural g 92.64
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 92.32
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 90.12
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 90.0
3h41_A 311 NLP/P60 family protein; NLPC/P60 family protein, s 89.72
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 89.19
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 89.05
1wil_A89 KIAA1045 protein; ring finger domain, structural g 88.43
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 87.83
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 87.56
2k16_A75 Transcription initiation factor TFIID subunit 3; p 87.06
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 85.82
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
Probab=99.74  E-value=2.9e-18  Score=119.70  Aligned_cols=75  Identities=20%  Similarity=0.419  Sum_probs=67.5

Q ss_pred             eeEeeeec-----cceeeccCCCEEEEeEecCCCeEEEEecCCCCceeeeeEEe--------------------------
Q psy9673          82 SFIRFFLN-----ILDLNFKKDDIVILRRKIDNNWFYGEVNGTTGAFPMSYVQI--------------------------  130 (162)
Q Consensus        82 ~~~~~~~~-----~~el~~~~gd~i~v~~~~~~~w~~g~~~~~~G~~P~~~v~~--------------------------  130 (162)
                      ..++++|+     ..+|+|.+||+|.|+.+.+++||.|+.+|+.|+||++||+.                          
T Consensus        12 ~~~~al~dy~~~~~~eLs~~~Gd~i~vl~~~~~gWw~g~~~g~~G~~P~~yv~~~~~~~~~~~~~p~~~~~~~~al~dy~   91 (193)
T 1ng2_A           12 QTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYT   91 (193)
T ss_dssp             EEEECSSCBCCSSTTCCCBCTTCEEEEEECCTTSCCEEEECCCCCCCCGGGCCCSSCSSCSCCCCCCTTCEEEEESSCBC
T ss_pred             cEEEEcCCcCCCCCCcCCCCCCCEEEEEEecCCCeEEEEECCeeeEechheEEeeccccccchhhccccceeeeeccccC
Confidence            44666776     78999999999999999999999999999999999999863                          


Q ss_pred             ---------------------cCCeEEEEECCeEEeecCCCeEeccC
Q psy9673         131 ---------------------DNNWFYGEVNGTTGAFPMSYVQFVWY  156 (162)
Q Consensus       131 ---------------------~~~w~~g~~~g~~g~~p~~~~~~~~~  156 (162)
                                           +++||.|+++|+.|+||++||+.+..
T Consensus        92 a~~~~eLs~~~Gd~i~vl~~~~~gWw~g~~~g~~G~~P~~yv~~~~~  138 (193)
T 1ng2_A           92 AVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQ  138 (193)
T ss_dssp             CCSTTBCCBCTTCEEEEEECCTTSEEEEEETTEEEEEEGGGEEETTS
T ss_pred             CCCCCcccccCCCEEEEEEecCCCeEEEEECCCEEEEehHHeEECCC
Confidence                                 67999999999999999999999865



>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3h41_A NLP/P60 family protein; NLPC/P60 family protein, structural genomics, joint center F structural genomics, JCSG; HET: DGL PG4; 1.79A {Bacillus cereus atcc 10987} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-12
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 6e-11
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 7e-11
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 3e-10
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 4e-10
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 4e-10
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-10
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 6e-10
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 7e-10
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 1e-09
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 3e-09
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 3e-09
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 5e-09
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 9e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-08
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-08
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-08
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 3e-08
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 3e-08
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 4e-08
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 4e-08
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 4e-08
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 5e-08
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 7e-08
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 8e-08
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 8e-08
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 2e-07
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 2e-07
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 3e-07
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 4e-07
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 7e-07
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 7e-07
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 7e-07
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 8e-07
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 1e-06
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-06
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 2e-06
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-06
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 3e-06
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 4e-06
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 4e-06
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 5e-06
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 5e-06
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 6e-06
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 1e-05
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 1e-05
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-05
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 3e-05
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 4e-05
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 5e-05
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 5e-05
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 8e-05
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 1e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-04
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 4e-04
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 4e-04
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 5e-04
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 8e-04
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 0.002
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 58.5 bits (141), Expect = 1e-12
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 6  LNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHK-ELRCPECRVLVECKVDELP 64
          +  +LEC +CL+ +        C H FCK C+ ++++  K   +CP C+   +     L 
Sbjct: 18 MQKILECPICLELI-KEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCK--NDITKRSLQ 74

Query: 65 PNVLLMRILEGLFPLVVSF 83
           +    +++E L  ++ +F
Sbjct: 75 ESTRFSQLVEELLKIICAF 93


>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.67
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.66
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.65
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.59
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.58
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.47
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.46
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.45
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.45
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.45
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.44
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.43
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.43
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.42
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.39
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.39
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.37
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.37
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.35
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.35
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.34
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.31
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.31
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.31
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.31
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.3
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.3
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.29
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.29
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.28
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.26
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.25
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.24
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.24
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.24
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.24
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.23
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.22
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.21
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.21
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.2
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.2
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.2
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.19
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.17
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.17
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.16
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.16
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.14
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.13
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.11
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.11
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.11
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.11
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.05
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.05
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.03
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.03
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.01
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 98.92
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 98.91
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 98.91
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 98.89
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 98.84
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 98.78
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.76
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 98.75
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.71
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 98.66
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 98.66
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.65
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.63
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 98.58
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 98.58
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 98.55
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 98.51
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.45
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.42
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 98.4
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 98.39
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 98.31
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 98.29
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.17
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 98.09
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 98.04
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 97.75
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 97.73
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 97.66
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 97.58
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 97.55
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 97.34
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 97.11
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 96.98
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.53
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 95.82
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 95.52
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 95.5
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 95.27
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 95.07
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 95.04
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 92.84
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 92.36
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 91.49
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 88.65
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 88.51
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 88.51
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 87.92
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 86.88
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 86.62
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 86.47
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 84.13
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 82.87
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 82.59
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 82.22
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 81.17
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 80.06
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.67  E-value=1.2e-17  Score=99.11  Aligned_cols=70  Identities=17%  Similarity=0.304  Sum_probs=60.9

Q ss_pred             cCCCccccccccccccCCCEEcccCCccchhcHHHHHhcCCCcccccccccccccccCCCcchhhhhhhhcccc
Q psy9673           5 TLNDLLECSVCLDRLDTSSKVLPCQHTFCKKCLEEIVSSHKELRCPECRVLVECKVDELPPNVLLMRILEGLFP   78 (162)
Q Consensus         5 ~~~~~l~C~iC~~~~~~~p~~~~C~H~fC~~Cl~~~~~~~~~~~Cp~Cr~~~~~~~~~l~~n~~l~~i~e~~~~   78 (162)
                      .+-++|.|+||++++. +|++++|||+||..||.+|+...+ ..||.|+..+.  ...+.+|..++++++.+..
T Consensus         3 eiP~~l~CpIc~~l~~-dPv~~~cGhtfc~~ci~~~l~~~~-~~cP~c~~~l~--~~~l~pN~~L~~~I~~~l~   72 (80)
T d2c2la2           3 DIPDYLCGKISFELMR-EPCITPSGITYDRKDIEEHLQRVG-HFNPVTRSPLT--QEQLIPNLAMKEVIDAFIS   72 (80)
T ss_dssp             CCCSTTBCTTTCSBCS-SEEECSSCCEEETTHHHHHHHHTC-SSCTTTCCCCC--GGGCEECHHHHHHHHHHHT
T ss_pred             CCCccccCcCcCchhh-hhcccCCcCeecHHHHHHHHhcCC-ccCCCcccccc--ccccccHHHHHHHHHHHHH
Confidence            4568999999999999 889999999999999999997543 47999999887  5678899999999988654



>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure