Diaphorina citri psyllid: psy967


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKCPPSVSERAGALSDTP
cccEEEEEEEccccEEEEEEEEECcccccEEEEEEECcccccccCEEEEEccccEEEEEcccCEEEcccccccccccccccc
*PAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKC***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKCPPSVSERAGALSDTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Superoxide dismutase [Cu-Zn] Destroys radicals which are normally produced within the cells and which are toxic to biological systems.confidentP60052
Superoxide dismutase [Cu-Zn] Destroys radicals which are normally produced within the cells and which are toxic to biological systems.confidentP00441
Superoxide dismutase [Cu-Zn] Destroys radicals which are normally produced within the cells and which are toxic to biological systems.confidentP61851

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000303 [BP]response to superoxideprobableGO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0042554 [BP]superoxide anion generationprobableGO:0072593, GO:0009987, GO:0044237, GO:0008150, GO:0006801, GO:0008152
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0009410 [BP]response to xenobiotic stimulusprobableGO:0042221, GO:0050896, GO:0008150
GO:0005507 [MF]copper ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0045541 [BP]negative regulation of cholesterol biosynthetic processprobableGO:0051055, GO:0009892, GO:0080090, GO:0009890, GO:0019216, GO:0045939, GO:0019218, GO:0008150, GO:0090206, GO:0009889, GO:0090181, GO:0065007, GO:0045833, GO:0010894, GO:0048519, GO:0046890, GO:0050810, GO:0019222, GO:0045540, GO:0050789
GO:0010038 [BP]response to metal ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0031667 [BP]response to nutrient levelsprobableGO:0009991, GO:0008150, GO:0050896, GO:0009605
GO:0004784 [MF]superoxide dismutase activityprobableGO:0016721, GO:0016209, GO:0003674, GO:0003824, GO:0016491
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0060047 [BP]heart contractionprobableGO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0003015, GO:0044699, GO:0003008
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0001819 [BP]positive regulation of cytokine productionprobableGO:0051240, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789
GO:0051597 [BP]response to methylmercuryprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0030346 [MF]protein phosphatase 2B bindingprobableGO:0019899, GO:0019903, GO:0019902, GO:0003674, GO:0005488, GO:0005515
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0019725 [BP]cellular homeostasisprobableGO:0009987, GO:0042592, GO:0065007, GO:0008150, GO:0044763, GO:0065008, GO:0044699
GO:0032839 [CC]dendrite cytoplasmprobableGO:0005737, GO:0032838, GO:0044463, GO:0044464, GO:0030425, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0005623, GO:0043005, GO:0044424, GO:0042995
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0007568 [BP]agingprobableGO:0044767, GO:0032502, GO:0008150, GO:0044699
GO:0000187 [BP]activation of MAPK activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CE1, chain A
Confidence level:very confident
Coverage over the Query: 4-52
View the alignment between query and template
View the model in PyMOL
Template: 2R9R, chain B
Confidence level:probable
Coverage over the Query: 49-74
View the alignment between query and template
View the model in PyMOL