Psyllid ID: psy967

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKCPPSVSERAGALSDTP
cccEEEEEEEccccEEEEEEEEEEcccccEEEEEEEEcccccccEEEEEEccccEEEEEcccEEEEcccccccccccccccc
cccEEEEEEEccccEEEEEEEEEccccccEEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEccccccHHcccccccc
MPAIKAVCVlnnepvkgtifftqehadspvkvtgeiqgleedgglnlmNFTVFRAILDYYkgqvikcppsvseragalsdtp
MPAIKAVCVLNNEPVKGTIFftqehadspVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGqvikcppsvseragalsdtp
MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKCPPSVSERAGALSDTP
***IKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKC***************
*PAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKC***************
MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKCPPS************
*PAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKCPPS************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDGGLNLMNFTVFRAILDYYKGQVIKCPPSVSERAGALSDTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
Q95086152 Superoxide dismutase [Cu- yes N/A 0.426 0.230 0.611 2e-05
P41973153 Superoxide dismutase [Cu- N/A N/A 0.560 0.300 0.509 2e-05
Q9U4X5153 Superoxide dismutase [Cu- N/A N/A 0.426 0.228 0.583 3e-05
Q9U4X3153 Superoxide dismutase [Cu- N/A N/A 0.426 0.228 0.583 3e-05
Q9U4X2153 Superoxide dismutase [Cu- N/A N/A 0.426 0.228 0.583 4e-05
Q9U4X4153 Superoxide dismutase [Cu- N/A N/A 0.426 0.228 0.583 4e-05
P61852153 Superoxide dismutase [Cu- N/A N/A 0.426 0.228 0.583 7e-05
P61854153 Superoxide dismutase [Cu- N/A N/A 0.426 0.228 0.583 7e-05
P61851153 Superoxide dismutase [Cu- yes N/A 0.426 0.228 0.583 7e-05
P61853153 Superoxide dismutase [Cu- N/A N/A 0.426 0.228 0.583 7e-05
>sp|Q95086|SODC_DROPS Superoxide dismutase [Cu-Zn] OS=Drosophila pseudoobscura pseudoobscura GN=Sod PE=3 SV=3 Back     alignment and function desciption
 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 1/36 (2%)

Query: 4  IKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGL 39
          +KAVCV+N +  KGT+FF QE +++PVKVTGE+ GL
Sbjct: 2  VKAVCVINGD-AKGTVFFEQETSEAPVKVTGEVLGL 36
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|P41973|SODC_DROWI Superoxide dismutase [Cu-Zn] OS=Drosophila willistoni GN=Sod PE=3 SV=2 Back     alignment and function description
>sp|Q9U4X5|SODC_DROOR Superoxide dismutase [Cu-Zn] OS=Drosophila orena GN=Sod PE=3 SV=3 Back     alignment and function description
>sp|Q9U4X3|SODC_DROYA Superoxide dismutase [Cu-Zn] OS=Drosophila yakuba GN=Sod PE=3 SV=3 Back     alignment and function description
>sp|Q9U4X2|SODC_DROTE Superoxide dismutase [Cu-Zn] OS=Drosophila teissieri GN=Sod PE=3 SV=3 Back     alignment and function description
>sp|Q9U4X4|SODC_DROER Superoxide dismutase [Cu-Zn] OS=Drosophila erecta GN=Sod PE=3 SV=3 Back     alignment and function description
>sp|P61852|SODC_DROSI Superoxide dismutase [Cu-Zn] OS=Drosophila simulans GN=Sod PE=3 SV=2 Back     alignment and function description
>sp|P61854|SODC_DROSE Superoxide dismutase [Cu-Zn] OS=Drosophila sechellia GN=Sod PE=3 SV=2 Back     alignment and function description
>sp|P61851|SODC_DROME Superoxide dismutase [Cu-Zn] OS=Drosophila melanogaster GN=Sod PE=1 SV=2 Back     alignment and function description
>sp|P61853|SODC_DROMA Superoxide dismutase [Cu-Zn] OS=Drosophila mauritiana GN=Sod PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
251823681167 copper zinc superoxide dismutase [Diapho 0.609 0.299 0.843 6e-16
359843230154 superoxide dismutase [Schistocerca grega 0.439 0.233 0.777 6e-07
308208146156 Cu/Zn superoxide dismutase [Bemisia taba 0.426 0.224 0.742 1e-06
42932668758 Cu-Zn superoxide dismutase [Coptotermes 0.487 0.689 0.707 2e-06
91081867153 PREDICTED: similar to Cu-Zn superoxide d 0.475 0.254 0.682 9e-06
99109665154 Cu/Zn-superoxide dismutase [Haliotis dis 0.475 0.253 0.675 2e-05
110734438154 Cu/Zn-superoxide dismutase [Haliotis dis 0.475 0.253 0.675 2e-05
242247211152 superoxide dismutase [Cu-Zn]-like [Acyrt 0.463 0.25 0.631 3e-05
121543935153 putative superoxide dismutase Cu-Zn [Mac 0.475 0.254 0.65 3e-05
34733404153 Cu-Zn superoxide dismutase 1 [Lasius nig 0.463 0.248 0.605 5e-05
>gi|251823681|dbj|BAH83704.1| copper zinc superoxide dismutase [Diaphorina citri] Back     alignment and taxonomy information
 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 1/51 (1%)

Query: 1  MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEE-DGGLNLMNF 50
          MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEE + G ++  F
Sbjct: 14 MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEGNHGFHIHEF 64

Source: Diaphorina citri

Species: Diaphorina citri

Genus: Diaphorina

Family: Psyllidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|359843230|gb|AEV89750.1| superoxide dismutase [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|308208146|gb|ADO20320.1| Cu/Zn superoxide dismutase [Bemisia tabaci] Back     alignment and taxonomy information
>gi|429326687|gb|AFZ78679.1| Cu-Zn superoxide dismutase [Coptotermes formosanus] Back     alignment and taxonomy information
>gi|91081867|ref|XP_968284.1| PREDICTED: similar to Cu-Zn superoxide dismutase 1 [Tribolium castaneum] gi|270006342|gb|EFA02790.1| hypothetical protein TcasGA2_TC007011 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|99109665|gb|ABF67508.1| Cu/Zn-superoxide dismutase [Haliotis discus discus] Back     alignment and taxonomy information
>gi|110734438|gb|ABG88844.1| Cu/Zn-superoxide dismutase [Haliotis discus discus] Back     alignment and taxonomy information
>gi|242247211|ref|NP_001156243.1| superoxide dismutase [Cu-Zn]-like [Acyrthosiphon pisum] gi|239799399|dbj|BAH70622.1| ACYPI007471 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|121543935|gb|ABM55632.1| putative superoxide dismutase Cu-Zn [Maconellicoccus hirsutus] Back     alignment and taxonomy information
>gi|34733404|gb|AAQ81639.1| Cu-Zn superoxide dismutase 1 [Lasius niger] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
FB|FBgn0003462153 Sod "Superoxide dismutase" [Dr 0.426 0.228 0.583 1e-06
UNIPROTKB|F1N8Q1155 SOD1 "Superoxide dismutase [Cu 0.597 0.316 0.461 4.3e-06
UNIPROTKB|P80566154 SOD1 "Superoxide dismutase [Cu 0.597 0.318 0.461 4.3e-06
UNIPROTKB|Q8HXP8154 SOD1 "Superoxide dismutase [Cu 0.475 0.253 0.575 4.3e-06
UNIPROTKB|Q8HXP9154 SOD1 "Superoxide dismutase [Cu 0.475 0.253 0.575 4.3e-06
UNIPROTKB|Q8HXQ0154 SOD1 "Superoxide dismutase [Cu 0.475 0.253 0.575 4.3e-06
UNIPROTKB|Q8HXQ1154 SOD1 "Superoxide dismutase [Cu 0.475 0.253 0.575 4.3e-06
UNIPROTKB|Q8HXQ2154 SOD1 "Superoxide dismutase [Cu 0.475 0.253 0.575 4.3e-06
UNIPROTKB|Q8HXQ4155 SOD1 "Superoxide dismutase [Cu 0.475 0.251 0.585 4.3e-06
DICTYBASE|DDB_G0281493151 sodD "superoxide dismutase" [D 0.5 0.271 0.511 9e-06
FB|FBgn0003462 Sod "Superoxide dismutase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 112 (44.5 bits), Expect = 1.0e-06, P = 1.0e-06
 Identities = 21/36 (58%), Positives = 29/36 (80%)

Query:     4 IKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGL 39
             +KAVCV+N +  KGT+FF QE + +PVKV+GE+ GL
Sbjct:     3 VKAVCVINGD-AKGTVFFEQESSGTPVKVSGEVCGL 37
GO:0019430 "removal of superoxide radicals" evidence=NAS
GO:0004784 "superoxide dismutase activity" evidence=IEA;NAS
GO:0008340 "determination of adult lifespan" evidence=IMP;TAS
GO:0005737 "cytoplasm" evidence=NAS
GO:0006801 "superoxide metabolic process" evidence=IEA;NAS
GO:0016209 "antioxidant activity" evidence=NAS
GO:0007568 "aging" evidence=TAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0008270 "zinc ion binding" evidence=IBA
GO:0005507 "copper ion binding" evidence=IBA
GO:0005829 "cytosol" evidence=IBA
GO:0005634 "nucleus" evidence=IBA
GO:0005739 "mitochondrion" evidence=IBA
UNIPROTKB|F1N8Q1 SOD1 "Superoxide dismutase [Cu-Zn]" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P80566 SOD1 "Superoxide dismutase [Cu-Zn]" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXP8 SOD1 "Superoxide dismutase [Cu-Zn]" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXP9 SOD1 "Superoxide dismutase [Cu-Zn]" [Cebus apella (taxid:9515)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXQ0 SOD1 "Superoxide dismutase [Cu-Zn]" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXQ1 SOD1 "Superoxide dismutase [Cu-Zn]" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXQ2 SOD1 "Superoxide dismutase [Cu-Zn]" [Macaca fuscata fuscata (taxid:9543)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXQ4 SOD1 "Superoxide dismutase [Cu-Zn]" [Pongo pygmaeus (taxid:9600)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281493 sodD "superoxide dismutase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P60052SODC_PANTR1, ., 1, 5, ., 1, ., 10.550.47560.2532yesN/A
P61851SODC_DROME1, ., 1, 5, ., 1, ., 10.58330.42680.2287yesN/A
Q95086SODC_DROPS1, ., 1, 5, ., 1, ., 10.61110.42680.2302yesN/A
P00441SODC_HUMAN1, ., 1, 5, ., 1, ., 10.550.47560.2532yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 7e-07
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 9e-06
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 1e-04
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information 
 Score = 43.7 bits (103), Expect = 7e-07
 Identities = 24/38 (63%), Positives = 28/38 (73%), Gaps = 2/38 (5%)

Query: 4  IKAVCVLN-NEPVKGTIFFTQEHADSPVKVTGEIQGLE 40
          +KAV VLN +E VKGTIFFTQE  D P  VTG + GL+
Sbjct: 2  VKAVAVLNSSEGVKGTIFFTQE-GDGPTTVTGSLSGLK 38

Length = 152
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
KOG3840|consensus 438 99.24
KOG0441|consensus154 99.12
PLN02386152 superoxide dismutase [Cu-Zn] 99.04
PLN02642164 copper, zinc superoxide dismutase 99.0
PLN02957238 copper, zinc superoxide dismutase 98.79
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 98.71
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 98.66
PRK15388177 Cu/Zn superoxide dismutase; Provisional 98.47
PRK10290173 superoxide dismutase; Provisional 98.35
KOG4656|consensus247 97.52
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 97.03
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 88.16
KOG3713|consensus 477 83.84
>KOG3840|consensus Back     alignment and domain information 
Probab=99.24  E-value=1.7e-12  Score=103.17  Aligned_cols=32  Identities=44%  Similarity=0.734  Sum_probs=29.3

Q ss_pred             CCceeeehhhHHhhhhhhcceeeCCCCceecc
Q psy967           44 GLNLMNFTVFRAILDYYKGQVIKCPPSVSERA   75 (82)
Q Consensus        44 gfHih~~~~~~~~~~~~~~~~~~~~~~~~~~~   75 (82)
                      -...++.+||||||||||+|+|+||++||||+
T Consensus       143 VAdGi~s~vFRAILdYYksG~iRCP~~vSvpE  174 (438)
T KOG3840|consen  143 VADGMTSSCFRAILDYYQSGTMRCPSSVSVSE  174 (438)
T ss_pred             hhcchhHHHHHHHHHHHhcCceeCCCCCchHH
Confidence            45568899999999999999999999999987

>KOG0441|consensus Back     alignment and domain information
>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information
>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>KOG4656|consensus Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
3l9y_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 1e-05
3l9e_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 1e-05
3ecw_A153 Crystal Structure Of The Als-Related Pathological M 3e-05
3qqd_A154 Human Sod1 H80r Variant, P212121 Crystal Form Lengt 5e-05
2zky_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 5e-05
2zkw_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 6e-05
1oez_W153 Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu 6e-05
3h2q_A153 Human Sod1 H80r Variant, P21 Crystal Form Length = 6e-05
3gqf_A153 Structural And Biophysical Properties Of The Pathog 6e-05
2nnx_A154 Crystal Structure Of The H46r, H48q Double Mutant O 6e-05
2c9s_A153 1.24 Angstroms Resolution Structure Of Zn-Zn Human 6e-05
2vr8_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 6e-05
3gtv_A153 Human-Mouse Sod1 Chimera Length = 153 6e-05
2wko_F154 Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 6e-05
3cqq_A153 Human Sod1 G85r Variant, Structure Ii Length = 153 6e-05
4b3e_A154 Structure Of Copper-Zinc Superoxide Dismutase Compl 6e-05
2vr7_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 6e-05
2vr6_A153 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 6e-05
4a7g_A153 Structure Of Human I113t Sod1 Mutant Complexed With 6e-05
1ozu_A153 Crystal Structure Of Familial Als Mutant S134n Of H 6e-05
1p1v_A153 Crystal Structure Of Fals-Associated Human Copper-Z 6e-05
3gzp_A153 Human Sod1 G93a Metal-Free Variant Length = 153 6e-05
3gzo_A154 Human Sod1 G93a Variant Length = 154 6e-05
1hl4_A154 The Structure Of Apo Type Human Cu, Zn Superoxide D 6e-05
1uxl_A153 I113t Mutant Of Human Sod1 Length = 153 6e-05
1hl5_A153 The Structure Of Holo Type Human Cu, Zn Superoxide 6e-05
3h2p_A153 Human Sod1 D124v Variant Length = 153 6e-05
3ltv_A153 Mouse-Human Sod1 Chimera Length = 153 1e-04
3gtt_A153 Mouse Sod1 Length = 153 1e-04
2wyz_A153 L38v Sod1 Mutant Complexed With Ump Length = 153 2e-04
2wyt_A153 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng 2e-04
4bd4_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 2e-04
4bcz_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 2e-04
1uxm_A153 A4v Mutant Of Human Sod1 Length = 153 2e-04
3gzq_A154 Human Sod1 A4v Metal-Free Variant Length = 154 2e-04
2xjl_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 4e-04
2gbu_A153 C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase 5e-04
3ce1_A168 Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE 5e-04
2r27_A154 Constitutively Zinc-Deficient Mutant Of Human Super 6e-04
1ptz_A153 Crystal Structure Of The Human Cu, Zn Superoxide Di 6e-04
3hff_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 6e-04
1azv_A153 Familial Als Mutant G37r Cuznsod (Human) Length = 1 6e-04
1n18_A154 Thermostable Mutant Of Human Superoxide Dismutase, 6e-04
1sos_A154 Atomic Structures Of Wild-type And Thermostable Mut 6e-04
1l3n_A153 The Solution Structure Of Reduced Dimeric Copper Zi 6e-04
2gbt_A153 C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 7e-04
1fun_A153 Superoxide Dismutase Mutant With Lys 136 Replaced B 7e-04
1mfm_A153 Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC 7e-04
4bcy_A153 Monomeric Human Cu,zn Superoxide Dismutase, Mutatio 7e-04
2xjk_A153 Monomeric Human Cu,Zn Superoxide Dismutase Length = 7e-04
>pdb|3L9Y|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM The Silkworm Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/39 (61%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
Query: 1  MPAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGL 39
          MPA KAVCVL  + V GT+FF Q+   SPV V+GE+QGL
Sbjct: 1  MPA-KAVCVLRGD-VSGTVFFDQQDEKSPVVVSGEVQGL 37
>pdb|3L9E|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM THE SILKWORM Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 Back     alignment and structure
>pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 Back     alignment and structure
>pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 Back     alignment and structure
>pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 Back     alignment and structure
>pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 Back     alignment and structure
>pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 Back     alignment and structure
>pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 Back     alignment and structure
>pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 Back     alignment and structure
>pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 Back     alignment and structure
>pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 Back     alignment and structure
>pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 Back     alignment and structure
>pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 Back     alignment and structure
>pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 Back     alignment and structure
>pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 Back     alignment and structure
>pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 Back     alignment and structure
>pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 Back     alignment and structure
>pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 Back     alignment and structure
>pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 Back     alignment and structure
>pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 Back     alignment and structure
>pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 Back     alignment and structure
>pdb|4BD4|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form, Mutant H43f Length = 110 Back     alignment and structure
>pdb|4BCZ|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form. Length = 110 Back     alignment and structure
>pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 Back     alignment and structure
>pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 Back     alignment and structure
>pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 Back     alignment and structure
>pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 Back     alignment and structure
>pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 Back     alignment and structure
>pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 Back     alignment and structure
>pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 Back     alignment and structure
>pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 Back     alignment and structure
>pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 Back     alignment and structure
>pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 Back     alignment and structure
>pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 Back     alignment and structure
>pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 Back     alignment and structure
>pdb|4BCY|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Mutation H43f Length = 153 Back     alignment and structure
>pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 8e-13
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 8e-12
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 2e-11
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 2e-11
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 4e-11
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 4e-11
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 7e-11
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 3e-10
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 9e-10
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 1e-09
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 3e-09
1do5_A154 Human copper chaperone for superoxide dismutase do 3e-08
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 8e-07
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 1e-06
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 2e-06
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 3e-06
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 3e-05
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 5e-05
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 1e-04
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 5e-04
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 6e-04
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
 Score = 58.5 bits (142), Expect = 8e-13
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 3  AIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEE 41
          + +AV VL  E V GTI+ TQ+  +    + GEI+GL  
Sbjct: 1  SNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTP 39
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 99.43
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 99.41
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 99.38
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 99.35
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 99.32
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 99.3
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 99.3
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 99.29
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 99.27
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 99.27
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 99.25
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 99.23
1do5_A154 Human copper chaperone for superoxide dismutase do 99.14
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 99.06
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 98.98
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 98.91
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 98.82
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 98.75
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 98.67
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 98.6
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 98.55
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 98.48
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 98.48
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 98.48
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 98.45
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 96.84
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 96.6
3kvt_A115 Potassium channel protein SHAW; tetramerization do 96.38
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 96.36
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 96.24
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 96.19
3drx_A 202 BTB/POZ domain-containing protein KCTD5; golgi, gr 95.23
2r9r_B 514 Paddle chimera voltage gated potassium channel KV; 92.24
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
Probab=99.43  E-value=1.4e-13  Score=95.83  Aligned_cols=49  Identities=47%  Similarity=0.840  Sum_probs=44.0

Q ss_pred             CceeEEEEecCCCeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeeeh
Q psy967            2 PAIKAVCVLNNEPVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNFT   51 (82)
Q Consensus         2 ~~~kAVcVL~G~~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~~   51 (82)
                      |++||||+|+|+ |+|+|+|+|..+++.++|+++|+||+||. |||||.+-
T Consensus         1 ~~~~Ava~l~G~-v~G~v~f~q~~~~~~v~v~~~l~GL~pG~hg~HIHe~G   50 (154)
T 3l9y_A            1 MPAKAVCVLRGD-VSGTVFFDQQDEKSPVVVSGEVQGLTKGKHGFHVHEFG   50 (154)
T ss_dssp             -CEEEEEEEEES-SEEEEEEEESSTTSCEEEEEEEESCCSEEEEEEEESCC
T ss_pred             CCeEEEEEEcCC-CEEEEEEEEeCCCCcEEEEEEEECCCCCCccEEEEecC
Confidence            678999999995 99999999998667899999999999994 99999875
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 82
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 5e-10
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 6e-09
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 7e-09
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 2e-07
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 4e-06
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 2e-05
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 2e-05
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 7e-04
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 0.002
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 50.4 bits (120), Expect = 5e-10
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 1/40 (2%)

Query: 3  AIKAVCVLN-NEPVKGTIFFTQEHADSPVKVTGEIQGLEE 41
          A KAVCVL  + PV+G I F Q+ ++ PVKV G I+GL E
Sbjct: 1  ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTE 40
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 99.34
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 99.29
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 99.25
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 99.22
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 99.22
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 98.97
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 98.69
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 98.67
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 98.45
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 98.32
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 98.31
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 97.81
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 95.61
d1t1da_100 Shaker potassium channel {California sea hare (Apl 93.5
d3kvta_103 akv3.1 voltage-gated potassium channel {California 92.72
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Blood fluke (Schistosoma mansoni) [TaxId: 6183]

Probab=99.34  E-value=7.2e-13  Score=90.66  Aligned_cols=48  Identities=42%  Similarity=0.749  Sum_probs=44.4

Q ss_pred             ceeEEEEecCC-CeEEEEEEEEcCCCCCeEEEEEEecCCCCc-CCceeee
Q psy967            3 AIKAVCVLNNE-PVKGTIFFTQEHADSPVKVTGEIQGLEEDG-GLNLMNF   50 (82)
Q Consensus         3 ~~kAVcVL~G~-~VsGtV~FtQ~~~~~~V~ItG~I~GL~Pg~-gfHih~~   50 (82)
                      -|||||+|+|+ +++|+|+|+|..++++++|+++|+||+||. |||||.+
T Consensus         3 ~~~Ava~~~g~~~v~G~v~F~Q~~~~~~v~V~~~l~GL~pG~hg~HIHe~   52 (156)
T d1to4a_           3 NMKAVCVMTGTAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEF   52 (156)
T ss_dssp             CCEEEEEEBCSSSCEEEEEEEESSTTSCEEEEEEEESCCSEEEEEEEESC
T ss_pred             ceEEEEEEcCCCCcEEEEEEEEECCCCcEEEEEEEccCCCcceeeEEcCC
Confidence            47999999987 899999999998888999999999999995 9999975
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure